Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96RI1

- NR1H4_HUMAN

UniProt

Q96RI1 - NR1H4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Bile acid receptor

Gene

NR1H4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Ligand-activated transcription factor. Receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. Represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two distinct mechanisms. Activates the intestinal bile acid-binding protein (IBABP). Activates the transcription of bile salt export pump ABCB11 by directly recruiting histone methyltransferase CARM1 to this locus.8 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei375 – 3751AgonistBy similarity
Binding sitei383 – 3831AgonistBy similarity
Binding sitei461 – 4611AgonistBy similarity
Binding sitei483 – 4831AgonistBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi134 – 20976Nuclear receptorPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri137 – 15721NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri173 – 19725NR C4-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. bile acid binding Source: BHF-UCL
  2. bile acid receptor activity Source: UniProtKB
  3. chenodeoxycholic acid binding Source: UniProtKB
  4. ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity Source: BHF-UCL
  5. ligand-dependent nuclear receptor binding Source: BHF-UCL
  6. peptide binding Source: Ensembl
  7. RNA polymerase II distal enhancer sequence-specific DNA binding Source: BHF-UCL
  8. RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity Source: BHF-UCL
  9. RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription Source: BHF-UCL
  10. sequence-specific DNA binding Source: UniProtKB
  11. sequence-specific DNA binding transcription factor activity Source: ProtInc
  12. steroid hormone receptor activity Source: Ensembl
  13. thyroid hormone receptor activity Source: InterPro
  14. transcription coactivator activity Source: ProtInc
  15. transcription corepressor activity Source: ProtInc
  16. zinc ion binding Source: InterPro

GO - Biological processi

  1. bile acid metabolic process Source: Ensembl
  2. cellular response to acid chemical Source: BHF-UCL
  3. cellular response to organonitrogen compound Source: BHF-UCL
  4. digestive tract development Source: Ensembl
  5. gene expression Source: Reactome
  6. intracellular bile acid receptor signaling pathway Source: UniProtKB
  7. intracellular receptor signaling pathway Source: BHF-UCL
  8. negative regulation of bile acid biosynthetic process Source: UniProtKB
  9. negative regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  10. nitrogen catabolite activation of transcription from RNA polymerase II promoter Source: BHF-UCL
  11. positive regulation of ammonia assimilation cycle Source: Ensembl
  12. positive regulation of glutamate metabolic process Source: BHF-UCL
  13. positive regulation of transcription from RNA polymerase II promoter Source: BHF-UCL
  14. regulation of bile acid biosynthetic process Source: BHF-UCL
  15. regulation of carbohydrate metabolic process Source: Ensembl
  16. regulation of cholesterol metabolic process Source: BHF-UCL
  17. regulation of urea metabolic process Source: BHF-UCL
  18. response to glucose Source: Ensembl
  19. response to lipopolysaccharide Source: Ensembl
  20. signal transduction Source: ProtInc
  21. transcription initiation from RNA polymerase II promoter Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Activator, Receptor, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_15525. Nuclear Receptor transcription pathway.
SignaLinkiQ96RI1.

Names & Taxonomyi

Protein namesi
Recommended name:
Bile acid receptor
Alternative name(s):
Farnesoid X-activated receptor
Farnesol receptor HRR-1
Nuclear receptor subfamily 1 group H member 4
Retinoid X receptor-interacting protein 14
Short name:
RXR-interacting protein 14
Gene namesi
Name:NR1H4
Synonyms:BAR, FXR, HRR1, RIP14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:7967. NR1H4.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nuclear euchromatin Source: BHF-UCL
  2. nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

Orphaneti69665. Intrahepatic cholestasis of pregnancy.
PharmGKBiPA31752.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 486486Bile acid receptorPRO_0000053538Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei220 – 2201N6-methyllysine; by SETD71 Publication

Post-translational modificationi

Methylation may increase transactivation of target genes.1 Publication

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiQ96RI1.
PRIDEiQ96RI1.

PTM databases

PhosphoSiteiQ96RI1.

Expressioni

Gene expression databases

BgeeiQ96RI1.
CleanExiHS_NR1H4.
ExpressionAtlasiQ96RI1. baseline and differential.
GenevestigatoriQ96RI1.

Organism-specific databases

HPAiHPA047699.

Interactioni

Subunit structurei

Heterodimer of NR1H4 and RXR. After activation by agonist binding, interacts with a coactivator, NCOA1 or NCOA2 (By similarity). Interacts with CARM1 and SMARD1.By similarity9 Publications

Protein-protein interaction databases

BioGridi115296. 26 interactions.
DIPiDIP-39370N.
IntActiQ96RI1. 5 interactions.
STRINGi9606.ENSP00000315442.

Structurei

Secondary structure

1
486
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi261 – 27414
Helixi281 – 2899
Helixi297 – 31721
Helixi322 – 3243
Helixi327 – 35226
Helixi356 – 36712
Turni368 – 3703
Turni373 – 3753
Helixi376 – 38712
Turni388 – 3903
Helixi393 – 40412
Beta strandi407 – 4115
Helixi415 – 43622
Helixi443 – 45513
Helixi457 – 47014
Helixi477 – 4837

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1OSHX-ray1.80A258-486[»]
1OSKmodel-A258-486[»]
3BEJX-ray1.90A/B249-486[»]
3DCTX-ray2.50A252-486[»]
3DCUX-ray2.95A252-486[»]
3FLIX-ray2.00A258-486[»]
3FXVX-ray2.26A258-486[»]
3GD2X-ray3.20A260-486[»]
3HC5X-ray2.60A257-486[»]
3HC6X-ray3.20A257-486[»]
3L1BX-ray1.90A258-486[»]
3OKHX-ray2.50A258-486[»]
3OKIX-ray2.00A/C258-486[»]
3OLFX-ray1.90A/C258-486[»]
3OMKX-ray1.90A/C258-486[»]
3OMMX-ray2.10A/C258-486[»]
3OOFX-ray2.29A/C258-486[»]
3OOKX-ray2.29A/C258-486[»]
3P88X-ray2.95A258-486[»]
3P89X-ray2.30A258-486[»]
3RUTX-ray3.00A258-486[»]
3RUUX-ray2.50A258-486[»]
3RVFX-ray3.10A257-486[»]
4II6X-ray2.90A/B258-473[»]
ProteinModelPortaliQ96RI1.
SMRiQ96RI1. Positions 128-485.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96RI1.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni256 – 474219Ligand-bindingAdd
BLAST
Regioni342 – 3509Agonist bindingBy similarity

Sequence similaritiesi

Contains 1 nuclear receptor DNA-binding domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri137 – 15721NR C4-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri173 – 19725NR C4-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiNOG302915.
GeneTreeiENSGT00760000118837.
HOVERGENiHBG108655.
InParanoidiQ96RI1.
KOiK08537.
OMAiMKPAKGV.
OrthoDBiEOG7DC25S.
PhylomeDBiQ96RI1.
TreeFamiTF316304.

Family and domain databases

Gene3Di1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProiIPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001728. ThyrH_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view]
PfamiPF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view]
PRINTSiPR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00546. THYROIDHORMR.
SMARTiSM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view]
SUPFAMiSSF48508. SSF48508. 1 hit.
PROSITEiPS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96RI1-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVMQFQGLEN PIQISPHCSC TPSGFFMEMM SMKPAKGVLT EQVAGPLGQN
60 70 80 90 100
LEVEPYSQYS NVQFPQVQPQ ISSSSYYSNL GFYPQQPEEW YSPGIYELRR
110 120 130 140 150
MPAETLYQGE TEVAEMPVTK KPRMGASAGR IKGDELCVVC GDRASGYHYN
160 170 180 190 200
ALTCEGCKGF FRRSITKNAV YKCKNGGNCV MDMYMRRKCQ ECRLRKCKEM
210 220 230 240 250
GMLAECMYTG LLTEIQCKSK RLRKNVKQHA DQTVNEDSEG RDLRQVTSTT
260 270 280 290 300
KSCREKTELT PDQQTLLHFI MDSYNKQRMP QEITNKILKE EFSAEENFLI
310 320 330 340 350
LTEMATNHVQ VLVEFTKKLP GFQTLDHEDQ IALLKGSAVE AMFLRSAEIF
360 370 380 390 400
NKKLPSGHSD LLEERIRNSG ISDEYITPMF SFYKSIGELK MTQEEYALLT
410 420 430 440 450
AIVILSPDRQ YIKDREAVEK LQEPLLDVLQ KLCKIHQPEN PQHFACLLGR
460 470 480
LTELRTFNHH HAEMLMSWRV NDHKFTPLLC EIWDVQ
Length:486
Mass (Da):55,914
Last modified:April 26, 2004 - v2
Checksum:iC23283576A8CF76B
GO
Isoform 2 (identifier: Q96RI1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     207-210: Missing.

Show »
Length:482
Mass (Da):55,462
Checksum:i2B9B563B0999C91D
GO
Isoform 3 (identifier: Q96RI1-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAK → MGSKMNLIEHSHLPTTDEFSFSENLF

Show »
Length:476
Mass (Da):54,862
Checksum:i37FB0351FB447544
GO
Isoform 4 (identifier: Q96RI1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAK → MGSKMNLIEHSHLPTTDEFSFSENLF
     207-210: Missing.

Show »
Length:472
Mass (Da):54,409
Checksum:i0A53D414B9049C4C
GO
Isoform 5 (identifier: Q96RI1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAK → MGSKMNLIEHSHLPTTDEFSFSENLF
     159-209: Missing.

Note: No experimental confirmation available.

Show »
Length:425
Mass (Da):48,795
Checksum:iF29FB6B5C5FA2257
GO

Sequence cautioni

The sequence BC144183 differs from that shown. Reason: Frameshift at position 156.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti198 – 1981K → R in AAI44185. (PubMed:15489334)Curated
Sequence conflicti217 – 2171C → V in BC144183. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MVMQF…MKPAK → MGSKMNLIEHSHLPTTDEFS FSENLF in isoform 3, isoform 4 and isoform 5. 3 PublicationsVSP_010135Add
BLAST
Alternative sequencei159 – 20951Missing in isoform 5. 1 PublicationVSP_044547Add
BLAST
Alternative sequencei207 – 2104Missing in isoform 2 and isoform 4. 2 PublicationsVSP_003665

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U68233 mRNA. Translation: AAB08107.1.
AF384555 mRNA. Translation: AAK60271.1.
AF478445 mRNA. Translation: AAM53550.1.
AF478446 mRNA. Translation: AAM53551.1.
AK296612 mRNA. Translation: BAH12398.1.
AC010200 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97639.1.
BC144183 mRNA. No translation available.
BC144184 mRNA. Translation: AAI44185.1.
BC130573 mRNA. Translation: AAI30574.1.
CCDSiCCDS55873.1. [Q96RI1-1]
CCDS55874.1. [Q96RI1-5]
CCDS55875.1. [Q96RI1-4]
CCDS55876.1. [Q96RI1-3]
CCDS9078.1. [Q96RI1-2]
RefSeqiNP_001193906.1. NM_001206977.1. [Q96RI1-1]
NP_001193907.1. NM_001206978.1. [Q96RI1-5]
NP_001193908.1. NM_001206979.1. [Q96RI1-1]
NP_001193921.1. NM_001206992.1. [Q96RI1-4]
NP_001193922.1. NM_001206993.1. [Q96RI1-3]
NP_005114.1. NM_005123.3. [Q96RI1-2]
UniGeneiHs.282735.
Hs.732506.

Genome annotation databases

EnsembliENST00000188403; ENSP00000188403; ENSG00000012504. [Q96RI1-4]
ENST00000392986; ENSP00000376712; ENSG00000012504. [Q96RI1-1]
ENST00000548884; ENSP00000448506; ENSG00000012504. [Q96RI1-2]
ENST00000549996; ENSP00000448978; ENSG00000012504. [Q96RI1-5]
ENST00000551379; ENSP00000447149; ENSG00000012504. [Q96RI1-3]
GeneIDi9971.
KEGGihsa:9971.
UCSCiuc001ths.2. human. [Q96RI1-4]
uc001tht.2. human. [Q96RI1-3]

Polymorphism databases

DMDMi46577705.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Wikipedia

Farnesoid X receptor entry

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U68233 mRNA. Translation: AAB08107.1 .
AF384555 mRNA. Translation: AAK60271.1 .
AF478445 mRNA. Translation: AAM53550.1 .
AF478446 mRNA. Translation: AAM53551.1 .
AK296612 mRNA. Translation: BAH12398.1 .
AC010200 Genomic DNA. No translation available.
CH471054 Genomic DNA. Translation: EAW97639.1 .
BC144183 mRNA. No translation available.
BC144184 mRNA. Translation: AAI44185.1 .
BC130573 mRNA. Translation: AAI30574.1 .
CCDSi CCDS55873.1. [Q96RI1-1 ]
CCDS55874.1. [Q96RI1-5 ]
CCDS55875.1. [Q96RI1-4 ]
CCDS55876.1. [Q96RI1-3 ]
CCDS9078.1. [Q96RI1-2 ]
RefSeqi NP_001193906.1. NM_001206977.1. [Q96RI1-1 ]
NP_001193907.1. NM_001206978.1. [Q96RI1-5 ]
NP_001193908.1. NM_001206979.1. [Q96RI1-1 ]
NP_001193921.1. NM_001206992.1. [Q96RI1-4 ]
NP_001193922.1. NM_001206993.1. [Q96RI1-3 ]
NP_005114.1. NM_005123.3. [Q96RI1-2 ]
UniGenei Hs.282735.
Hs.732506.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1OSH X-ray 1.80 A 258-486 [» ]
1OSK model - A 258-486 [» ]
3BEJ X-ray 1.90 A/B 249-486 [» ]
3DCT X-ray 2.50 A 252-486 [» ]
3DCU X-ray 2.95 A 252-486 [» ]
3FLI X-ray 2.00 A 258-486 [» ]
3FXV X-ray 2.26 A 258-486 [» ]
3GD2 X-ray 3.20 A 260-486 [» ]
3HC5 X-ray 2.60 A 257-486 [» ]
3HC6 X-ray 3.20 A 257-486 [» ]
3L1B X-ray 1.90 A 258-486 [» ]
3OKH X-ray 2.50 A 258-486 [» ]
3OKI X-ray 2.00 A/C 258-486 [» ]
3OLF X-ray 1.90 A/C 258-486 [» ]
3OMK X-ray 1.90 A/C 258-486 [» ]
3OMM X-ray 2.10 A/C 258-486 [» ]
3OOF X-ray 2.29 A/C 258-486 [» ]
3OOK X-ray 2.29 A/C 258-486 [» ]
3P88 X-ray 2.95 A 258-486 [» ]
3P89 X-ray 2.30 A 258-486 [» ]
3RUT X-ray 3.00 A 258-486 [» ]
3RUU X-ray 2.50 A 258-486 [» ]
3RVF X-ray 3.10 A 257-486 [» ]
4II6 X-ray 2.90 A/B 258-473 [» ]
ProteinModelPortali Q96RI1.
SMRi Q96RI1. Positions 128-485.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115296. 26 interactions.
DIPi DIP-39370N.
IntActi Q96RI1. 5 interactions.
STRINGi 9606.ENSP00000315442.

Chemistry

BindingDBi Q96RI1.
ChEMBLi CHEMBL2047.
DrugBanki DB06777. Chenodeoxycholic acid.
GuidetoPHARMACOLOGYi 603.

PTM databases

PhosphoSitei Q96RI1.

Polymorphism databases

DMDMi 46577705.

Proteomic databases

PaxDbi Q96RI1.
PRIDEi Q96RI1.

Protocols and materials databases

DNASUi 9971.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000188403 ; ENSP00000188403 ; ENSG00000012504 . [Q96RI1-4 ]
ENST00000392986 ; ENSP00000376712 ; ENSG00000012504 . [Q96RI1-1 ]
ENST00000548884 ; ENSP00000448506 ; ENSG00000012504 . [Q96RI1-2 ]
ENST00000549996 ; ENSP00000448978 ; ENSG00000012504 . [Q96RI1-5 ]
ENST00000551379 ; ENSP00000447149 ; ENSG00000012504 . [Q96RI1-3 ]
GeneIDi 9971.
KEGGi hsa:9971.
UCSCi uc001ths.2. human. [Q96RI1-4 ]
uc001tht.2. human. [Q96RI1-3 ]

Organism-specific databases

CTDi 9971.
GeneCardsi GC12P100867.
HGNCi HGNC:7967. NR1H4.
HPAi HPA047699.
MIMi 603826. gene.
neXtProti NX_Q96RI1.
Orphaneti 69665. Intrahepatic cholestasis of pregnancy.
PharmGKBi PA31752.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302915.
GeneTreei ENSGT00760000118837.
HOVERGENi HBG108655.
InParanoidi Q96RI1.
KOi K08537.
OMAi MKPAKGV.
OrthoDBi EOG7DC25S.
PhylomeDBi Q96RI1.
TreeFami TF316304.

Enzyme and pathway databases

Reactomei REACT_15525. Nuclear Receptor transcription pathway.
SignaLinki Q96RI1.

Miscellaneous databases

EvolutionaryTracei Q96RI1.
GeneWikii Farnesoid_X_receptor.
GenomeRNAii 9971.
NextBioi 37658.
PROi Q96RI1.
SOURCEi Search...

Gene expression databases

Bgeei Q96RI1.
CleanExi HS_NR1H4.
ExpressionAtlasi Q96RI1. baseline and differential.
Genevestigatori Q96RI1.

Family and domain databases

Gene3Di 1.10.565.10. 2 hits.
3.30.50.10. 1 hit.
InterProi IPR008946. Nucl_hormone_rcpt_ligand-bd.
IPR000536. Nucl_hrmn_rcpt_lig-bd_core.
IPR001723. Str_hrmn_rcpt.
IPR001728. ThyrH_rcpt.
IPR001628. Znf_hrmn_rcpt.
IPR013088. Znf_NHR/GATA.
[Graphical view ]
Pfami PF00104. Hormone_recep. 1 hit.
PF00105. zf-C4. 1 hit.
[Graphical view ]
PRINTSi PR00398. STRDHORMONER.
PR00047. STROIDFINGER.
PR00546. THYROIDHORMR.
SMARTi SM00430. HOLI. 1 hit.
SM00399. ZnF_C4. 1 hit.
[Graphical view ]
SUPFAMi SSF48508. SSF48508. 1 hit.
PROSITEi PS00031. NUCLEAR_REC_DBD_1. 1 hit.
PS51030. NUCLEAR_REC_DBD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The identification of the cDNA coding for HRR-1, a novel human farnesol receptor."
    Papetti M., Wood N., Lohmar P.D., Bowman M.R.
    Submitted (AUG-1996) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "Functional analysis of human farnesol receptor (NR1H4) splicing variant."
    Han J.-I., Bok S.-H., Jeong T.-S.
    Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
  3. "Generation of multiple farnesoid-X-receptor isoforms through the use of alternative promoters."
    Huber R.M., Murphy K., Miao B., Link J.R., Cunningham M.R., Rupar M.J., Gunyuzlu P.L., Haws T.F. Jr., Kassam A., Powell F., Hollis G.F., Young P.R., Mukherjee R., Burn T.C.
    Gene 290:35-43(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon.
  5. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
  8. Cited for: FUNCTION.
  9. Cited for: FUNCTION.
  10. "Definition of a novel growth factor-dependent signal cascade for the suppression of bile acid biosynthesis."
    Holt J.A., Luo G., Billin A.N., Bisi J., McNeill Y.Y., Kozarsky K.F., Donahee M., Wang D.Y., Mansfield T.A., Kliewer S.A., Goodwin B., Jones S.A.
    Genes Dev. 17:1581-1591(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "BAF60a mediates critical interactions between nuclear receptors and the BRG1 chromatin-remodeling complex for transactivation."
    Hsiao P.W., Fryer C.J., Trotter K.W., Wang W., Archer T.K.
    Mol. Cell. Biol. 23:6210-6220(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SMARD1.
  12. "Ligand-dependent activation of the farnesoid X-receptor directs arginine methylation of histone H3 by CARM1."
    Ananthanarayanan M., Li S., Balasubramaniyan N., Suchy F.J., Walsh M.J.
    J. Biol. Chem. 279:54348-54357(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CARM1.
  13. "Direct methylation of FXR by Set7/9, a lysine methyltransferase, regulates the expression of FXR target genes."
    Balasubramaniyan N., Ananthanarayanan M., Suchy F.J.
    Am. J. Physiol. 302:G937-G947(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: METHYLATION AT LYS-220 BY SETD7.
  14. Cited for: X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 258-476 IN COMPLEX WITH SYNTHETIC AGONIST FEXARAMINE, FUNCTION, INTERACTION WITH NCOA1.
  15. "Structural basis for bile acid binding and activation of the nuclear receptor FXR."
    Mi L.Z., Devarakonda S., Harp J.M., Han Q., Pellicciari R., Willson T.M., Khorasanizadeh S., Rastinejad F.
    Mol. Cell 11:1093-1100(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 241-469 IN COMPLEXES WITH CHENODEOXYCHOLIC ACID ANALOGS AND NCOA2 COACTIVATOR PEPTIDE.
  16. Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 252-486 IN COMPLEX WITH SYNTHETIC AGONIST, FUNCTION, INTERACTION WITH NCOA1.
  17. "Identification of a potent synthetic FXR agonist with an unexpected mode of binding and activation."
    Soisson S.M., Parthasarathy G., Adams A.D., Sahoo S., Sitlani A., Sparrow C., Cui J., Becker J.W.
    Proc. Natl. Acad. Sci. U.S.A. 105:5337-5342(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 249-486 IN COMPLEX WITH STEROID ANALOG MFA-1 AND NCOA1 PEPTIDE, INTERACTION WITH NCOA1, DOMAIN.
  18. Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 260-486 IN COMPLEX WITH SYNTHETIC AGONIST, FUNCTION, INTERACTION WITH NCOA1.
  19. Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 257-486 IN COMPLEX WITH SYNTHETIC AGONIST, FUNCTION, INTERACTION WITH NCOA1.
  20. "Discovery of XL335 (WAY-362450), a highly potent, selective, and orally active agonist of the farnesoid X receptor (FXR)."
    Flatt B., Martin R., Wang T.L., Mahaney P., Murphy B., Gu X.H., Foster P., Li J., Pircher P., Petrowski M., Schulman I., Westin S., Wrobel J., Yan G., Bischoff E., Daige C., Mohan R.
    J. Med. Chem. 52:904-907(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 258-486 IN COMPLEX WITH SYNTHETIC AGONIST.
  21. "Improvement of physiochemical properties of the tetrahydroazepinoindole series of farnesoid X receptor (FXR) agonists: beneficial modulation of lipids in primates."
    Lundquist J.T., Harnish D.C., Kim C.Y., Mehlmann J.F., Unwalla R.J., Phipps K.M., Crawley M.L., Commons T., Green D.M., Xu W., Hum W.T., Eta J.E., Feingold I., Patel V., Evans M.J., Lai K., Borges-Marcucci L., Mahaney P.E., Wrobel J.E.
    J. Med. Chem. 53:1774-1787(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.9 ANGSTROMS) OF 248-476 IN COMPLEX WITH SYNTHETIC AGONIST.

Entry informationi

Entry nameiNR1H4_HUMAN
AccessioniPrimary (citable) accession number: Q96RI1
Secondary accession number(s): A1L4K5
, B7Z412, B7ZM06, F8VYG8, Q8NFP5, Q8NFP6, Q92943
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 27, 2002
Last sequence update: April 26, 2004
Last modified: October 29, 2014
This is version 145 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3