Q96RD9 (FCRL5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fc receptor-like protein 5 Short name=FcR-like protein 5 Short name=FcRL5 Alternative name(s): BXMAS1 Fc receptor homolog 5 Short name=FcRH5 Immune receptor translocation-associated protein 2 CD_antigen=CD307e | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 977 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells. Ref.1 |
| Subcellular location | |
| Tissue specificity | Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level). Ref.2 Ref.9 Ref.10 |
| Domain | Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM) By similarity. |
| Involvement in disease | A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup1(q21q32). Ref.2 |
| Sequence similarities | Contains 8 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96RD9-1) Also known as: IRTA2c; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96RD9-2) The sequence of this isoform differs from the canonical sequence as follows: 103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT 125-977: Missing. | ||||||
| Isoform 3 (identifier: Q96RD9-3) Also known as: IRTA2a; The sequence of this isoform differs from the canonical sequence as follows: 747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN 760-977: Missing. | ||||||
| Isoform 4 (identifier: Q96RD9-4) Also known as: IRTA2b; The sequence of this isoform differs from the canonical sequence as follows: 561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP 593-977: Missing. | ||||||
| Isoform 5 (identifier: Q96RD9-5) Also known as: IRTA2d; The sequence of this isoform differs from the canonical sequence as follows: 152-152: H → Q 153-977: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 15 | 15 | Potential | ||||||||
| Chain | 16 – 977 | 962 | Fc receptor-like protein 5 | PRO_0000225622 | |||||||
Regions | |||||||||||
| Topological domain | 16 – 851 | 836 | Extracellular Potential | ||||||||
| Transmembrane | 852 – 872 | 21 | Helical; Potential | ||||||||
| Topological domain | 873 – 977 | 105 | Cytoplasmic Potential | ||||||||
| Domain | 23 – 101 | 79 | Ig-like C2-type 1 | ||||||||
| Domain | 188 – 271 | 84 | Ig-like C2-type 2 | ||||||||
| Domain | 287 – 374 | 88 | Ig-like C2-type 3 | ||||||||
| Domain | 380 – 463 | 84 | Ig-like C2-type 4 | ||||||||
| Domain | 473 – 556 | 84 | Ig-like C2-type 5 | ||||||||
| Domain | 566 – 651 | 86 | Ig-like C2-type 6 | ||||||||
| Domain | 659 – 744 | 86 | Ig-like C2-type 7 | ||||||||
| Domain | 752 – 834 | 83 | Ig-like C2-type 8 | ||||||||
| Motif | 897 – 902 | 6 | ITIM motif 1 | ||||||||
| Motif | 910 – 915 | 6 | ITIM motif 2 | ||||||||
| Motif | 922 – 927 | 6 | ITIM motif 3 | ||||||||
| Motif | 952 – 957 | 6 | ITIM motif 4 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 383 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 44 ↔ 85 | By similarity | |||||||||
| Disulfide bond | 211 ↔ 260 | By similarity | |||||||||
| Disulfide bond | 308 ↔ 355 | By similarity | |||||||||
| Disulfide bond | 401 ↔ 448 | By similarity | |||||||||
| Disulfide bond | 494 ↔ 541 | By similarity | |||||||||
| Disulfide bond | 587 ↔ 634 | By similarity | |||||||||
| Disulfide bond | 680 ↔ 727 | By similarity | |||||||||
| Disulfide bond | 773 ↔ 819 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 103 – 124 | 22 | ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2. | VSP_017379 | |||||||
| Alternative sequence | 125 – 977 | 853 | Missing in isoform 2. | VSP_017380 | |||||||
| Alternative sequence | 152 | 1 | H → Q in isoform 5. | VSP_017381 | |||||||
| Alternative sequence | 153 – 977 | 825 | Missing in isoform 5. | VSP_017382 | |||||||
| Alternative sequence | 561 – 592 | 32 | VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4. | VSP_017383 | |||||||
| Alternative sequence | 593 – 977 | 385 | Missing in isoform 4. | VSP_017384 | |||||||
| Alternative sequence | 747 – 759 | 13 | VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3. | VSP_017385 | |||||||
| Alternative sequence | 760 – 977 | 218 | Missing in isoform 3. | VSP_017386 | |||||||
| Natural variant | 267 | 1 | Y → H. Ref.1 Ref.2 Ref.3 Ref.6 Corresponds to variant rs6679793 [ dbSNP | Ensembl ]. | VAR_025447 | |||||||
| Natural variant | 269 | 1 | V → I. Ref.3 Ref.8 Corresponds to variant rs12036228 [ dbSNP | Ensembl ]. | VAR_025448 | |||||||
| Natural variant | 418 | 1 | G → D. Ref.1 Ref.2 Ref.3 Ref.6 Ref.8 Corresponds to variant rs2012199 [ dbSNP | Ensembl ]. | VAR_025449 | |||||||
| Natural variant | 427 | 1 | N → K. Corresponds to variant rs16838748 [ dbSNP | Ensembl ]. | VAR_056044 | |||||||
| Natural variant | 457 | 1 | Q → R. Corresponds to variant rs34868810 [ dbSNP | Ensembl ]. | VAR_056045 | |||||||
| Natural variant | 466 | 1 | V → I. Ref.1 Ref.2 Ref.3 Ref.6 Ref.8 Corresponds to variant rs6427384 [ dbSNP | Ensembl ]. | VAR_025450 | |||||||
| Natural variant | 687 | 1 | S → C in a breast cancer sample; somatic mutation. Ref.11 | VAR_035514 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 733 | 1 | L → P in AAK50059. Ref.1 | ||||||||
| Sequence conflict | 890 | 1 | S → P in AAK50059. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "BXMAS1 identifies a cluster of homologous genes differentially expressed in B cells." Nakayama Y., Weissman S.M., Bothwell A.L.M. Biochem. Biophys. Res. Commun. 285:830-837(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS HIS-267; ASP-418 AND ILE-466. |
| [2] | "IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy." Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R. Immunity 14:277-289(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY, DISEASE, VARIANTS HIS-267; ASP-418 AND ILE-466. |
| [3] | "Identification of a family of Fc receptor homologs with preferential B cell expression." Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D. Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-267; ILE-269; ASP-418 AND ILE-466. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Lymph node. |
| [6] | Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A. Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-267; ASP-418 AND ILE-466. |
| [7] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-269; ASP-418 AND ILE-466. |
| [9] | "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells." Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R. Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [10] | "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia." Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A. Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [11] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-687. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF369794 mRNA. Translation: AAK50059.2. AF343662 mRNA. Translation: AAK31325.1. AF343663 mRNA. Translation: AAK31326.1. AF343664 mRNA. Translation: AAK31327.1. AF343665 mRNA. Translation: AAK31328.1. AF397453 mRNA. Translation: AAK93971.1. AY358085 mRNA. Translation: AAQ88452.1. AL834187 mRNA. Translation: CAH56486.1. EF064730 Genomic DNA. Translation: ABK41913.1. AL353899, AL135929 Genomic DNA. Translation: CAH71427.1. BC101066 mRNA. Translation: AAI01067.1. BC101067 mRNA. Translation: AAI01068.1. BC101069 mRNA. Translation: AAI01070.1. |
| IPI | IPI00290135. IPI00432728. IPI00644064. IPI00647675. IPI00738292. |
| RefSeq | NP_001182317.1. NM_001195388.1. NP_112571.2. NM_031281.2. |
| UniGene | Hs.415950. |
3D structure databases | |
| ProteinModelPortal | Q96RD9. |
| SMR | Q96RD9. Positions 21-838. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000354691. |
Protein family/group databases | |
| MEROPS | I43.001. |
PTM databases | |
| PhosphoSite | Q96RD9. |
Polymorphism databases | |
| DMDM | 296439341. |
Proteomic databases | |
| PaxDb | Q96RD9. |
| PRIDE | Q96RD9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000361835; ENSP00000354691; ENSG00000143297. ENST00000368188; ENSP00000357171; ENSG00000143297. ENST00000368189; ENSP00000357172; ENSG00000143297. ENST00000368190; ENSP00000357173; ENSG00000143297. |
| GeneID | 83416. |
| KEGG | hsa:83416. |
| UCSC | uc001fqu.3. human. uc001fqv.1. human. uc010phv.1. human. |
Organism-specific databases | |
| CTD | 83416. |
| GeneCards | GC01M157477. |
| HGNC | HGNC:18508. FCRL5. |
| HPA | HPA039998. |
| MIM | 605877. gene. |
| neXtProt | NX_Q96RD9. |
| PharmGKB | PA142671769. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG151212. |
| HOVERGEN | HBG074073. |
| KO | K06727. |
| OMA | LPILYQF. |
| OrthoDB | EOG4V436X. |
Gene expression databases | |
| ArrayExpress | Q96RD9. |
| Bgee | Q96RD9. |
| CleanEx | HS_FCRL5. |
| Genevestigator | Q96RD9. |
| GermOnline | ENSG00000143297. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 9 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. IPR003598. Ig_sub2. [Graphical view] |
| SMART | SM00409. IG. 7 hits. SM00408. IGc2. 1 hit. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 8 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83416. |
| NextBio | 72304. |
| SOURCE | Search... |
Entry information
| Entry name | FCRL5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96RD9 Secondary accession number(s): A0N0M2 Q6UY46 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
