Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96RD9

- FCRL5_HUMAN

UniProt

Q96RD9 - FCRL5_HUMAN

Protein

Fc receptor-like protein 5

Gene

FCRL5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 117 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells.1 Publication

    Keywords - Molecular functioni

    Receptor

    Protein family/group databases

    MEROPSiI43.001.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fc receptor-like protein 5
    Short name:
    FcR-like protein 5
    Short name:
    FcRL5
    Alternative name(s):
    BXMAS1
    Fc receptor homolog 5
    Short name:
    FcRH5
    Immune receptor translocation-associated protein 2
    CD_antigen: CD307e
    Gene namesi
    Name:FCRL5
    Synonyms:FCRH5, IRTA2
    ORF Names:UNQ503/PRO820
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:18508. FCRL5.

    Subcellular locationi

    Cell membrane 1 Publication; Single-pass type I membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell
    3. receptor complex Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup1(q21q32).1 Publication

    Organism-specific databases

    PharmGKBiPA142671769.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1515Sequence AnalysisAdd
    BLAST
    Chaini16 – 977962Fc receptor-like protein 5PRO_0000225622Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi44 ↔ 85PROSITE-ProRule annotation
    Disulfide bondi211 ↔ 260PROSITE-ProRule annotation
    Disulfide bondi308 ↔ 355PROSITE-ProRule annotation
    Glycosylationi383 – 3831N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi401 ↔ 448PROSITE-ProRule annotation
    Disulfide bondi494 ↔ 541PROSITE-ProRule annotation
    Disulfide bondi587 ↔ 634PROSITE-ProRule annotation
    Disulfide bondi680 ↔ 727PROSITE-ProRule annotation
    Disulfide bondi773 ↔ 819PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ96RD9.
    PRIDEiQ96RD9.

    PTM databases

    PhosphoSiteiQ96RD9.

    Expressioni

    Tissue specificityi

    Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level).3 Publications

    Gene expression databases

    ArrayExpressiQ96RD9.
    BgeeiQ96RD9.
    CleanExiHS_FCRL5.
    GenevestigatoriQ96RD9.

    Organism-specific databases

    HPAiHPA039998.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000354691.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96RD9.
    SMRiQ96RD9. Positions 21-281, 344-731.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini16 – 851836ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini873 – 977105CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei852 – 87221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini23 – 10179Ig-like C2-type 1Add
    BLAST
    Domaini188 – 27184Ig-like C2-type 2Add
    BLAST
    Domaini287 – 37488Ig-like C2-type 3Add
    BLAST
    Domaini380 – 46384Ig-like C2-type 4Add
    BLAST
    Domaini473 – 55684Ig-like C2-type 5Add
    BLAST
    Domaini566 – 65186Ig-like C2-type 6Add
    BLAST
    Domaini659 – 74486Ig-like C2-type 7Add
    BLAST
    Domaini752 – 83483Ig-like C2-type 8Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi897 – 9026ITIM motif 1
    Motifi910 – 9156ITIM motif 2
    Motifi922 – 9276ITIM motif 3
    Motifi952 – 9576ITIM motif 4

    Domaini

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG151212.
    HOVERGENiHBG074073.
    KOiK06727.
    OMAiCERGASI.
    OrthoDBiEOG7BP81V.
    PhylomeDBiQ96RD9.
    TreeFamiTF351107.

    Family and domain databases

    Gene3Di2.60.40.10. 9 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    [Graphical view]
    SMARTiSM00409. IG. 7 hits.
    SM00408. IGc2. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 8 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96RD9-1) [UniParc]FASTAAdd to Basket

    Also known as: IRTA2c

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLLWVILLVL APVSGQFART PRPIIFLQPP WTTVFQGERV TLTCKGFRFY    50
    SPQKTKWYHR YLGKEILRET PDNILEVQES GEYRCQAQGS PLSSPVHLDF 100
    SSASLILQAP LSVFEGDSVV LRCRAKAEVT LNNTIYKNDN VLAFLNKRTD 150
    FHIPHACLKD NGAYRCTGYK ESCCPVSSNT VKIQVQEPFT RPVLRASSFQ 200
    PISGNPVTLT CETQLSLERS DVPLRFRFFR DDQTLGLGWS LSPNFQITAM 250
    WSKDSGFYWC KAATMPYSVI SDSPRSWIQV QIPASHPVLT LSPEKALNFE 300
    GTKVTLHCET QEDSLRTLYR FYHEGVPLRH KSVRCERGAS ISFSLTTENS 350
    GNYYCTADNG LGAKPSKAVS LSVTVPVSHP VLNLSSPEDL IFEGAKVTLH 400
    CEAQRGSLPI LYQFHHEGAA LERRSANSAG GVAISFSLTA EHSGNYYCTA 450
    DNGFGPQRSK AVSLSVTVPV SHPVLTLSSA EALTFEGATV TLHCEVQRGS 500
    PQILYQFYHE DMPLWSSSTP SVGRVSFSFS LTEGHSGNYY CTADNGFGPQ 550
    RSEVVSLFVT VPVSRPILTL RVPRAQAVVG DLLELHCEAP RGSPPILYWF 600
    YHEDVTLGSS SAPSGGEASF NLSLTAEHSG NYSCEANNGL VAQHSDTISL 650
    SVIVPVSRPI LTFRAPRAQA VVGDLLELHC EALRGSSPIL YWFYHEDVTL 700
    GKISAPSGGG ASFNLSLTTE HSGIYSCEAD NGLEAQRSEM VTLKVAVPVS 750
    RPVLTLRAPG THAAVGDLLE LHCEALRGSP LILYRFFHED VTLGNRSSPS 800
    GGASLNLSLT AEHSGNYSCE ADNGLGAQRS ETVTLYITGL TANRSGPFAT 850
    GVAGGLLSIA GLAAGALLLY CWLSRKAGRK PASDPARSPS DSDSQEPTYH 900
    NVPAWEELQP VYTNANPRGE NVVYSEVRII QEKKKHAVAS DPRHLRNKGS 950
    PIIYSEVKVA STPVSGSLFL ASSAPHR 977
    Length:977
    Mass (Da):106,437
    Last modified:May 18, 2010 - v3
    Checksum:i9545DA1B6A164FDD
    GO
    Isoform 2 (identifier: Q96RD9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT
         125-977: Missing.

    Show »
    Length:124
    Mass (Da):14,080
    Checksum:iD7915849A385455D
    GO
    Isoform 3 (identifier: Q96RD9-3) [UniParc]FASTAAdd to Basket

    Also known as: IRTA2a

    The sequence of this isoform differs from the canonical sequence as follows:
         747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN
         760-977: Missing.

    Show »
    Length:759
    Mass (Da):83,293
    Checksum:i11903D6E89081BC9
    GO
    Isoform 4 (identifier: Q96RD9-4) [UniParc]FASTAAdd to Basket

    Also known as: IRTA2b

    The sequence of this isoform differs from the canonical sequence as follows:
         561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP
         593-977: Missing.

    Show »
    Length:592
    Mass (Da):65,617
    Checksum:iD99E9511BC528621
    GO
    Isoform 5 (identifier: Q96RD9-5) [UniParc]FASTAAdd to Basket

    Also known as: IRTA2d

    The sequence of this isoform differs from the canonical sequence as follows:
         152-152: H → Q
         153-977: Missing.

    Show »
    Length:152
    Mass (Da):17,377
    Checksum:i0437E9CBE8D3792C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti733 – 7331L → P in AAK50059. (PubMed:11453668)Curated
    Sequence conflicti890 – 8901S → P in AAK50059. (PubMed:11453668)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti267 – 2671Y → H.4 Publications
    Corresponds to variant rs6679793 [ dbSNP | Ensembl ].
    VAR_025447
    Natural varianti269 – 2691V → I.2 Publications
    Corresponds to variant rs12036228 [ dbSNP | Ensembl ].
    VAR_025448
    Natural varianti418 – 4181G → D.5 Publications
    Corresponds to variant rs2012199 [ dbSNP | Ensembl ].
    VAR_025449
    Natural varianti427 – 4271N → K.
    Corresponds to variant rs16838748 [ dbSNP | Ensembl ].
    VAR_056044
    Natural varianti457 – 4571Q → R.
    Corresponds to variant rs34868810 [ dbSNP | Ensembl ].
    VAR_056045
    Natural varianti466 – 4661V → I.5 Publications
    Corresponds to variant rs6427384 [ dbSNP | Ensembl ].
    VAR_025450
    Natural varianti687 – 6871S → C in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035514

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei103 – 12422ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2. 2 PublicationsVSP_017379Add
    BLAST
    Alternative sequencei125 – 977853Missing in isoform 2. 2 PublicationsVSP_017380Add
    BLAST
    Alternative sequencei152 – 1521H → Q in isoform 5. 1 PublicationVSP_017381
    Alternative sequencei153 – 977825Missing in isoform 5. 1 PublicationVSP_017382Add
    BLAST
    Alternative sequencei561 – 59232VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4. 1 PublicationVSP_017383Add
    BLAST
    Alternative sequencei593 – 977385Missing in isoform 4. 1 PublicationVSP_017384Add
    BLAST
    Alternative sequencei747 – 75913VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3. 1 PublicationVSP_017385Add
    BLAST
    Alternative sequencei760 – 977218Missing in isoform 3. 1 PublicationVSP_017386Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF369794 mRNA. Translation: AAK50059.2.
    AF343662 mRNA. Translation: AAK31325.1.
    AF343663 mRNA. Translation: AAK31326.1.
    AF343664 mRNA. Translation: AAK31327.1.
    AF343665 mRNA. Translation: AAK31328.1.
    AF397453 mRNA. Translation: AAK93971.1.
    AY358085 mRNA. Translation: AAQ88452.1.
    AL834187 mRNA. Translation: CAH56486.1.
    EF064730 Genomic DNA. Translation: ABK41913.1.
    AL353899, AL135929 Genomic DNA. Translation: CAH71427.1.
    BC101066 mRNA. Translation: AAI01067.1.
    BC101067 mRNA. Translation: AAI01068.1.
    BC101069 mRNA. Translation: AAI01070.1.
    CCDSiCCDS1165.1. [Q96RD9-1]
    RefSeqiNP_001182317.1. NM_001195388.1.
    NP_112571.2. NM_031281.2. [Q96RD9-1]
    UniGeneiHs.415950.

    Genome annotation databases

    EnsembliENST00000361835; ENSP00000354691; ENSG00000143297. [Q96RD9-1]
    ENST00000368189; ENSP00000357172; ENSG00000143297. [Q96RD9-4]
    ENST00000368190; ENSP00000357173; ENSG00000143297. [Q96RD9-3]
    GeneIDi83416.
    KEGGihsa:83416.
    UCSCiuc001fqu.3. human. [Q96RD9-1]
    uc001fqv.1. human. [Q96RD9-4]
    uc010phv.1. human. [Q96RD9-3]

    Polymorphism databases

    DMDMi296439341.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF369794 mRNA. Translation: AAK50059.2 .
    AF343662 mRNA. Translation: AAK31325.1 .
    AF343663 mRNA. Translation: AAK31326.1 .
    AF343664 mRNA. Translation: AAK31327.1 .
    AF343665 mRNA. Translation: AAK31328.1 .
    AF397453 mRNA. Translation: AAK93971.1 .
    AY358085 mRNA. Translation: AAQ88452.1 .
    AL834187 mRNA. Translation: CAH56486.1 .
    EF064730 Genomic DNA. Translation: ABK41913.1 .
    AL353899 , AL135929 Genomic DNA. Translation: CAH71427.1 .
    BC101066 mRNA. Translation: AAI01067.1 .
    BC101067 mRNA. Translation: AAI01068.1 .
    BC101069 mRNA. Translation: AAI01070.1 .
    CCDSi CCDS1165.1. [Q96RD9-1 ]
    RefSeqi NP_001182317.1. NM_001195388.1.
    NP_112571.2. NM_031281.2. [Q96RD9-1 ]
    UniGenei Hs.415950.

    3D structure databases

    ProteinModelPortali Q96RD9.
    SMRi Q96RD9. Positions 21-281, 344-731.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000354691.

    Protein family/group databases

    MEROPSi I43.001.

    PTM databases

    PhosphoSitei Q96RD9.

    Polymorphism databases

    DMDMi 296439341.

    Proteomic databases

    PaxDbi Q96RD9.
    PRIDEi Q96RD9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361835 ; ENSP00000354691 ; ENSG00000143297 . [Q96RD9-1 ]
    ENST00000368189 ; ENSP00000357172 ; ENSG00000143297 . [Q96RD9-4 ]
    ENST00000368190 ; ENSP00000357173 ; ENSG00000143297 . [Q96RD9-3 ]
    GeneIDi 83416.
    KEGGi hsa:83416.
    UCSCi uc001fqu.3. human. [Q96RD9-1 ]
    uc001fqv.1. human. [Q96RD9-4 ]
    uc010phv.1. human. [Q96RD9-3 ]

    Organism-specific databases

    CTDi 83416.
    GeneCardsi GC01M157477.
    HGNCi HGNC:18508. FCRL5.
    HPAi HPA039998.
    MIMi 605877. gene.
    neXtProti NX_Q96RD9.
    PharmGKBi PA142671769.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG151212.
    HOVERGENi HBG074073.
    KOi K06727.
    OMAi CERGASI.
    OrthoDBi EOG7BP81V.
    PhylomeDBi Q96RD9.
    TreeFami TF351107.

    Miscellaneous databases

    GeneWikii FCRL5.
    GenomeRNAii 83416.
    NextBioi 72304.
    PROi Q96RD9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96RD9.
    Bgeei Q96RD9.
    CleanExi HS_FCRL5.
    Genevestigatori Q96RD9.

    Family and domain databases

    Gene3Di 2.60.40.10. 9 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    [Graphical view ]
    SMARTi SM00409. IG. 7 hits.
    SM00408. IGc2. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 8 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "BXMAS1 identifies a cluster of homologous genes differentially expressed in B cells."
      Nakayama Y., Weissman S.M., Bothwell A.L.M.
      Biochem. Biophys. Res. Commun. 285:830-837(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS HIS-267; ASP-418 AND ILE-466.
    2. "IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy."
      Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R.
      Immunity 14:277-289(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY, DISEASE, VARIANTS HIS-267; ASP-418 AND ILE-466.
    3. "Identification of a family of Fc receptor homologs with preferential B cell expression."
      Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
      Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-267; ILE-269; ASP-418 AND ILE-466.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Lymph node.
    6. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-267; ASP-418 AND ILE-466.
    7. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-269; ASP-418 AND ILE-466.
    9. "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
      Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
      Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    10. "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
      Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
      Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    11. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-687.

    Entry informationi

    Entry nameiFCRL5_HUMAN
    AccessioniPrimary (citable) accession number: Q96RD9
    Secondary accession number(s): A0N0M2
    , B7WNT9, B7WP94, Q495Q2, Q495Q4, Q5VYK9, Q6UY46
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 117 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3