Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fc receptor-like protein 5

Gene

FCRL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells.1 Publication

Keywords - Molecular functioni

Receptor

Enzyme and pathway databases

BioCyciZFISH:ENSG00000143297-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Fc receptor-like protein 5
Short name:
FcR-like protein 5
Short name:
FcRL5
Alternative name(s):
BXMAS1
Fc receptor homolog 5
Short name:
FcRH5
Immune receptor translocation-associated protein 2
CD_antigen: CD307e
Gene namesi
Name:FCRL5
Synonyms:FCRH5, IRTA2
ORF Names:UNQ503/PRO820
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:18508. FCRL5.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini16 – 851ExtracellularSequence analysisAdd BLAST836
Transmembranei852 – 872HelicalSequence analysisAdd BLAST21
Topological domaini873 – 977CytoplasmicSequence analysisAdd BLAST105

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB-SubCell
  • receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup(1)(q21q32).

Organism-specific databases

DisGeNETi83416.
OpenTargetsiENSG00000143297.
PharmGKBiPA142671769.

Polymorphism and mutation databases

BioMutaiFCRL5.
DMDMi296439341.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000022562216 – 977Fc receptor-like protein 5Add BLAST962

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi44 ↔ 85PROSITE-ProRule annotation
Disulfide bondi211 ↔ 260PROSITE-ProRule annotation
Disulfide bondi308 ↔ 355PROSITE-ProRule annotation
Glycosylationi383N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi401 ↔ 448PROSITE-ProRule annotation
Disulfide bondi494 ↔ 541PROSITE-ProRule annotation
Disulfide bondi587 ↔ 634PROSITE-ProRule annotation
Disulfide bondi680 ↔ 727PROSITE-ProRule annotation
Disulfide bondi773 ↔ 819PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ96RD9.
PeptideAtlasiQ96RD9.
PRIDEiQ96RD9.

PTM databases

iPTMnetiQ96RD9.
PhosphoSitePlusiQ96RD9.

Expressioni

Tissue specificityi

Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level).3 Publications

Gene expression databases

BgeeiENSG00000143297.
CleanExiHS_FCRL5.
GenevisibleiQ96RD9. HS.

Interactioni

Protein-protein interaction databases

BioGridi123640. 6 interactors.
IntActiQ96RD9. 3 interactors.
STRINGi9606.ENSP00000354691.

Structurei

3D structure databases

ProteinModelPortaliQ96RD9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini23 – 101Ig-like C2-type 1Add BLAST79
Domaini188 – 271Ig-like C2-type 2Add BLAST84
Domaini287 – 374Ig-like C2-type 3Add BLAST88
Domaini380 – 463Ig-like C2-type 4Add BLAST84
Domaini473 – 556Ig-like C2-type 5Add BLAST84
Domaini566 – 651Ig-like C2-type 6Add BLAST86
Domaini659 – 744Ig-like C2-type 7Add BLAST86
Domaini752 – 834Ig-like C2-type 8Add BLAST83

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi897 – 902ITIM motif 16
Motifi910 – 915ITIM motif 26
Motifi922 – 927ITIM motif 36
Motifi952 – 957ITIM motif 46

Domaini

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IH5T. Eukaryota.
ENOG410YF57. LUCA.
GeneTreeiENSGT00760000119130.
HOVERGENiHBG074073.
InParanoidiQ96RD9.
KOiK06727.
OMAiCETQEDS.
OrthoDBiEOG091G03OP.
PhylomeDBiQ96RD9.
TreeFamiTF351107.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 7 hits.
[Graphical view]
SMARTiSM00409. IG. 9 hits.
SM00408. IGc2. 8 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 9 hits.
PROSITEiPS50835. IG_LIKE. 8 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96RD9-1) [UniParc]FASTAAdd to basket
Also known as: IRTA2c

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLLWVILLVL APVSGQFART PRPIIFLQPP WTTVFQGERV TLTCKGFRFY
60 70 80 90 100
SPQKTKWYHR YLGKEILRET PDNILEVQES GEYRCQAQGS PLSSPVHLDF
110 120 130 140 150
SSASLILQAP LSVFEGDSVV LRCRAKAEVT LNNTIYKNDN VLAFLNKRTD
160 170 180 190 200
FHIPHACLKD NGAYRCTGYK ESCCPVSSNT VKIQVQEPFT RPVLRASSFQ
210 220 230 240 250
PISGNPVTLT CETQLSLERS DVPLRFRFFR DDQTLGLGWS LSPNFQITAM
260 270 280 290 300
WSKDSGFYWC KAATMPYSVI SDSPRSWIQV QIPASHPVLT LSPEKALNFE
310 320 330 340 350
GTKVTLHCET QEDSLRTLYR FYHEGVPLRH KSVRCERGAS ISFSLTTENS
360 370 380 390 400
GNYYCTADNG LGAKPSKAVS LSVTVPVSHP VLNLSSPEDL IFEGAKVTLH
410 420 430 440 450
CEAQRGSLPI LYQFHHEGAA LERRSANSAG GVAISFSLTA EHSGNYYCTA
460 470 480 490 500
DNGFGPQRSK AVSLSVTVPV SHPVLTLSSA EALTFEGATV TLHCEVQRGS
510 520 530 540 550
PQILYQFYHE DMPLWSSSTP SVGRVSFSFS LTEGHSGNYY CTADNGFGPQ
560 570 580 590 600
RSEVVSLFVT VPVSRPILTL RVPRAQAVVG DLLELHCEAP RGSPPILYWF
610 620 630 640 650
YHEDVTLGSS SAPSGGEASF NLSLTAEHSG NYSCEANNGL VAQHSDTISL
660 670 680 690 700
SVIVPVSRPI LTFRAPRAQA VVGDLLELHC EALRGSSPIL YWFYHEDVTL
710 720 730 740 750
GKISAPSGGG ASFNLSLTTE HSGIYSCEAD NGLEAQRSEM VTLKVAVPVS
760 770 780 790 800
RPVLTLRAPG THAAVGDLLE LHCEALRGSP LILYRFFHED VTLGNRSSPS
810 820 830 840 850
GGASLNLSLT AEHSGNYSCE ADNGLGAQRS ETVTLYITGL TANRSGPFAT
860 870 880 890 900
GVAGGLLSIA GLAAGALLLY CWLSRKAGRK PASDPARSPS DSDSQEPTYH
910 920 930 940 950
NVPAWEELQP VYTNANPRGE NVVYSEVRII QEKKKHAVAS DPRHLRNKGS
960 970
PIIYSEVKVA STPVSGSLFL ASSAPHR
Length:977
Mass (Da):106,437
Last modified:May 18, 2010 - v3
Checksum:i9545DA1B6A164FDD
GO
Isoform 2 (identifier: Q96RD9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT
     125-977: Missing.

Show »
Length:124
Mass (Da):14,080
Checksum:iD7915849A385455D
GO
Isoform 3 (identifier: Q96RD9-3) [UniParc]FASTAAdd to basket
Also known as: IRTA2a

The sequence of this isoform differs from the canonical sequence as follows:
     747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN
     760-977: Missing.

Show »
Length:759
Mass (Da):83,293
Checksum:i11903D6E89081BC9
GO
Isoform 4 (identifier: Q96RD9-4) [UniParc]FASTAAdd to basket
Also known as: IRTA2b

The sequence of this isoform differs from the canonical sequence as follows:
     561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP
     593-977: Missing.

Show »
Length:592
Mass (Da):65,617
Checksum:iD99E9511BC528621
GO
Isoform 5 (identifier: Q96RD9-5) [UniParc]FASTAAdd to basket
Also known as: IRTA2d

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: H → Q
     153-977: Missing.

Show »
Length:152
Mass (Da):17,377
Checksum:i0437E9CBE8D3792C
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti733L → P in AAK50059 (PubMed:11453668).Curated1
Sequence conflicti890S → P in AAK50059 (PubMed:11453668).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_025447267Y → H.4 PublicationsCorresponds to variant rs6679793dbSNPEnsembl.1
Natural variantiVAR_025448269V → I.2 PublicationsCorresponds to variant rs12036228dbSNPEnsembl.1
Natural variantiVAR_025449418G → D.5 PublicationsCorresponds to variant rs2012199dbSNPEnsembl.1
Natural variantiVAR_056044427N → K.Corresponds to variant rs16838748dbSNPEnsembl.1
Natural variantiVAR_056045457Q → R.Corresponds to variant rs34868810dbSNPEnsembl.1
Natural variantiVAR_025450466V → I.5 PublicationsCorresponds to variant rs6427384dbSNPEnsembl.1
Natural variantiVAR_035514687S → C in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017379103 – 124ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_017380125 – 977Missing in isoform 2. 2 PublicationsAdd BLAST853
Alternative sequenceiVSP_017381152H → Q in isoform 5. 1 Publication1
Alternative sequenceiVSP_017382153 – 977Missing in isoform 5. 1 PublicationAdd BLAST825
Alternative sequenceiVSP_017383561 – 592VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_017384593 – 977Missing in isoform 4. 1 PublicationAdd BLAST385
Alternative sequenceiVSP_017385747 – 759VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_017386760 – 977Missing in isoform 3. 1 PublicationAdd BLAST218

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF369794 mRNA. Translation: AAK50059.2.
AF343662 mRNA. Translation: AAK31325.1.
AF343663 mRNA. Translation: AAK31326.1.
AF343664 mRNA. Translation: AAK31327.1.
AF343665 mRNA. Translation: AAK31328.1.
AF397453 mRNA. Translation: AAK93971.1.
AY358085 mRNA. Translation: AAQ88452.1.
AL834187 mRNA. Translation: CAH56486.1.
EF064730 Genomic DNA. Translation: ABK41913.1.
AL353899, AL135929 Genomic DNA. Translation: CAH71427.1.
BC101066 mRNA. Translation: AAI01067.1.
BC101067 mRNA. Translation: AAI01068.1.
BC101069 mRNA. Translation: AAI01070.1.
CCDSiCCDS1165.1. [Q96RD9-1]
RefSeqiNP_001182317.1. NM_001195388.1.
NP_112571.2. NM_031281.2. [Q96RD9-1]
UniGeneiHs.415950.

Genome annotation databases

EnsembliENST00000361835; ENSP00000354691; ENSG00000143297. [Q96RD9-1]
ENST00000368189; ENSP00000357172; ENSG00000143297. [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297. [Q96RD9-3]
GeneIDi83416.
KEGGihsa:83416.
UCSCiuc001fqu.3. human. [Q96RD9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF369794 mRNA. Translation: AAK50059.2.
AF343662 mRNA. Translation: AAK31325.1.
AF343663 mRNA. Translation: AAK31326.1.
AF343664 mRNA. Translation: AAK31327.1.
AF343665 mRNA. Translation: AAK31328.1.
AF397453 mRNA. Translation: AAK93971.1.
AY358085 mRNA. Translation: AAQ88452.1.
AL834187 mRNA. Translation: CAH56486.1.
EF064730 Genomic DNA. Translation: ABK41913.1.
AL353899, AL135929 Genomic DNA. Translation: CAH71427.1.
BC101066 mRNA. Translation: AAI01067.1.
BC101067 mRNA. Translation: AAI01068.1.
BC101069 mRNA. Translation: AAI01070.1.
CCDSiCCDS1165.1. [Q96RD9-1]
RefSeqiNP_001182317.1. NM_001195388.1.
NP_112571.2. NM_031281.2. [Q96RD9-1]
UniGeneiHs.415950.

3D structure databases

ProteinModelPortaliQ96RD9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123640. 6 interactors.
IntActiQ96RD9. 3 interactors.
STRINGi9606.ENSP00000354691.

PTM databases

iPTMnetiQ96RD9.
PhosphoSitePlusiQ96RD9.

Polymorphism and mutation databases

BioMutaiFCRL5.
DMDMi296439341.

Proteomic databases

PaxDbiQ96RD9.
PeptideAtlasiQ96RD9.
PRIDEiQ96RD9.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000361835; ENSP00000354691; ENSG00000143297. [Q96RD9-1]
ENST00000368189; ENSP00000357172; ENSG00000143297. [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297. [Q96RD9-3]
GeneIDi83416.
KEGGihsa:83416.
UCSCiuc001fqu.3. human. [Q96RD9-1]

Organism-specific databases

CTDi83416.
DisGeNETi83416.
GeneCardsiFCRL5.
HGNCiHGNC:18508. FCRL5.
MIMi605877. gene.
neXtProtiNX_Q96RD9.
OpenTargetsiENSG00000143297.
PharmGKBiPA142671769.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IH5T. Eukaryota.
ENOG410YF57. LUCA.
GeneTreeiENSGT00760000119130.
HOVERGENiHBG074073.
InParanoidiQ96RD9.
KOiK06727.
OMAiCETQEDS.
OrthoDBiEOG091G03OP.
PhylomeDBiQ96RD9.
TreeFamiTF351107.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000143297-MONOMER.

Miscellaneous databases

GeneWikiiFCRL5.
GenomeRNAii83416.
PROiQ96RD9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143297.
CleanExiHS_FCRL5.
GenevisibleiQ96RD9. HS.

Family and domain databases

Gene3Di2.60.40.10. 10 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 7 hits.
[Graphical view]
SMARTiSM00409. IG. 9 hits.
SM00408. IGc2. 8 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 9 hits.
PROSITEiPS50835. IG_LIKE. 8 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFCRL5_HUMAN
AccessioniPrimary (citable) accession number: Q96RD9
Secondary accession number(s): A0N0M2
, B7WNT9, B7WP94, Q495Q2, Q495Q4, Q5VYK9, Q6UY46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 137 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.