SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96RD9

- FCRL5_HUMAN

UniProt

Q96RD9 - FCRL5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Fc receptor-like protein 5
Gene
FCRL5, FCRH5, IRTA2, UNQ503/PRO820
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells.1 Publication

Keywords - Molecular functioni

Receptor

Protein family/group databases

MEROPSiI43.001.

Names & Taxonomyi

Protein namesi
Recommended name:
Fc receptor-like protein 5
Short name:
FcR-like protein 5
Short name:
FcRL5
Alternative name(s):
BXMAS1
Fc receptor homolog 5
Short name:
FcRH5
Immune receptor translocation-associated protein 2
CD_antigen: CD307e
Gene namesi
Name:FCRL5
Synonyms:FCRH5, IRTA2
ORF Names:UNQ503/PRO820
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:18508. FCRL5.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini16 – 851836Extracellular Reviewed prediction
Add
BLAST
Transmembranei852 – 87221Helical; Reviewed prediction
Add
BLAST
Topological domaini873 – 977105Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
  3. receptor complex Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup1(q21q32).1 Publication

Organism-specific databases

PharmGKBiPA142671769.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1515 Reviewed prediction
Add
BLAST
Chaini16 – 977962Fc receptor-like protein 5
PRO_0000225622Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi44 ↔ 85 By similarity
Disulfide bondi211 ↔ 260 By similarity
Disulfide bondi308 ↔ 355 By similarity
Glycosylationi383 – 3831N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi401 ↔ 448 By similarity
Disulfide bondi494 ↔ 541 By similarity
Disulfide bondi587 ↔ 634 By similarity
Disulfide bondi680 ↔ 727 By similarity
Disulfide bondi773 ↔ 819 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ96RD9.
PRIDEiQ96RD9.

PTM databases

PhosphoSiteiQ96RD9.

Expressioni

Tissue specificityi

Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level).3 Publications

Gene expression databases

ArrayExpressiQ96RD9.
BgeeiQ96RD9.
CleanExiHS_FCRL5.
GenevestigatoriQ96RD9.

Organism-specific databases

HPAiHPA039998.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000354691.

Structurei

3D structure databases

ProteinModelPortaliQ96RD9.
SMRiQ96RD9. Positions 21-281, 344-731.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini23 – 10179Ig-like C2-type 1
Add
BLAST
Domaini188 – 27184Ig-like C2-type 2
Add
BLAST
Domaini287 – 37488Ig-like C2-type 3
Add
BLAST
Domaini380 – 46384Ig-like C2-type 4
Add
BLAST
Domaini473 – 55684Ig-like C2-type 5
Add
BLAST
Domaini566 – 65186Ig-like C2-type 6
Add
BLAST
Domaini659 – 74486Ig-like C2-type 7
Add
BLAST
Domaini752 – 83483Ig-like C2-type 8
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi897 – 9026ITIM motif 1
Motifi910 – 9156ITIM motif 2
Motifi922 – 9276ITIM motif 3
Motifi952 – 9576ITIM motif 4

Domaini

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG151212.
HOVERGENiHBG074073.
KOiK06727.
OMAiCERGASI.
OrthoDBiEOG7BP81V.
PhylomeDBiQ96RD9.
TreeFamiTF351107.

Family and domain databases

Gene3Di2.60.40.10. 9 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
SMARTiSM00409. IG. 7 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 8 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96RD9-1) [UniParc]FASTAAdd to Basket

Also known as: IRTA2c

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLLWVILLVL APVSGQFART PRPIIFLQPP WTTVFQGERV TLTCKGFRFY    50
SPQKTKWYHR YLGKEILRET PDNILEVQES GEYRCQAQGS PLSSPVHLDF 100
SSASLILQAP LSVFEGDSVV LRCRAKAEVT LNNTIYKNDN VLAFLNKRTD 150
FHIPHACLKD NGAYRCTGYK ESCCPVSSNT VKIQVQEPFT RPVLRASSFQ 200
PISGNPVTLT CETQLSLERS DVPLRFRFFR DDQTLGLGWS LSPNFQITAM 250
WSKDSGFYWC KAATMPYSVI SDSPRSWIQV QIPASHPVLT LSPEKALNFE 300
GTKVTLHCET QEDSLRTLYR FYHEGVPLRH KSVRCERGAS ISFSLTTENS 350
GNYYCTADNG LGAKPSKAVS LSVTVPVSHP VLNLSSPEDL IFEGAKVTLH 400
CEAQRGSLPI LYQFHHEGAA LERRSANSAG GVAISFSLTA EHSGNYYCTA 450
DNGFGPQRSK AVSLSVTVPV SHPVLTLSSA EALTFEGATV TLHCEVQRGS 500
PQILYQFYHE DMPLWSSSTP SVGRVSFSFS LTEGHSGNYY CTADNGFGPQ 550
RSEVVSLFVT VPVSRPILTL RVPRAQAVVG DLLELHCEAP RGSPPILYWF 600
YHEDVTLGSS SAPSGGEASF NLSLTAEHSG NYSCEANNGL VAQHSDTISL 650
SVIVPVSRPI LTFRAPRAQA VVGDLLELHC EALRGSSPIL YWFYHEDVTL 700
GKISAPSGGG ASFNLSLTTE HSGIYSCEAD NGLEAQRSEM VTLKVAVPVS 750
RPVLTLRAPG THAAVGDLLE LHCEALRGSP LILYRFFHED VTLGNRSSPS 800
GGASLNLSLT AEHSGNYSCE ADNGLGAQRS ETVTLYITGL TANRSGPFAT 850
GVAGGLLSIA GLAAGALLLY CWLSRKAGRK PASDPARSPS DSDSQEPTYH 900
NVPAWEELQP VYTNANPRGE NVVYSEVRII QEKKKHAVAS DPRHLRNKGS 950
PIIYSEVKVA STPVSGSLFL ASSAPHR 977
Length:977
Mass (Da):106,437
Last modified:May 18, 2010 - v3
Checksum:i9545DA1B6A164FDD
GO
Isoform 2 (identifier: Q96RD9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT
     125-977: Missing.

Show »
Length:124
Mass (Da):14,080
Checksum:iD7915849A385455D
GO
Isoform 3 (identifier: Q96RD9-3) [UniParc]FASTAAdd to Basket

Also known as: IRTA2a

The sequence of this isoform differs from the canonical sequence as follows:
     747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN
     760-977: Missing.

Show »
Length:759
Mass (Da):83,293
Checksum:i11903D6E89081BC9
GO
Isoform 4 (identifier: Q96RD9-4) [UniParc]FASTAAdd to Basket

Also known as: IRTA2b

The sequence of this isoform differs from the canonical sequence as follows:
     561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP
     593-977: Missing.

Show »
Length:592
Mass (Da):65,617
Checksum:iD99E9511BC528621
GO
Isoform 5 (identifier: Q96RD9-5) [UniParc]FASTAAdd to Basket

Also known as: IRTA2d

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: H → Q
     153-977: Missing.

Show »
Length:152
Mass (Da):17,377
Checksum:i0437E9CBE8D3792C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti267 – 2671Y → H.4 Publications
Corresponds to variant rs6679793 [ dbSNP | Ensembl ].
VAR_025447
Natural varianti269 – 2691V → I.2 Publications
Corresponds to variant rs12036228 [ dbSNP | Ensembl ].
VAR_025448
Natural varianti418 – 4181G → D.5 Publications
Corresponds to variant rs2012199 [ dbSNP | Ensembl ].
VAR_025449
Natural varianti427 – 4271N → K.
Corresponds to variant rs16838748 [ dbSNP | Ensembl ].
VAR_056044
Natural varianti457 – 4571Q → R.
Corresponds to variant rs34868810 [ dbSNP | Ensembl ].
VAR_056045
Natural varianti466 – 4661V → I.5 Publications
Corresponds to variant rs6427384 [ dbSNP | Ensembl ].
VAR_025450
Natural varianti687 – 6871S → C in a breast cancer sample; somatic mutation. 1 Publication
VAR_035514

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei103 – 12422ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2.
VSP_017379Add
BLAST
Alternative sequencei125 – 977853Missing in isoform 2.
VSP_017380Add
BLAST
Alternative sequencei152 – 1521H → Q in isoform 5.
VSP_017381
Alternative sequencei153 – 977825Missing in isoform 5.
VSP_017382Add
BLAST
Alternative sequencei561 – 59232VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4.
VSP_017383Add
BLAST
Alternative sequencei593 – 977385Missing in isoform 4.
VSP_017384Add
BLAST
Alternative sequencei747 – 75913VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3.
VSP_017385Add
BLAST
Alternative sequencei760 – 977218Missing in isoform 3.
VSP_017386Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti733 – 7331L → P in AAK50059. 1 Publication
Sequence conflicti890 – 8901S → P in AAK50059. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF369794 mRNA. Translation: AAK50059.2.
AF343662 mRNA. Translation: AAK31325.1.
AF343663 mRNA. Translation: AAK31326.1.
AF343664 mRNA. Translation: AAK31327.1.
AF343665 mRNA. Translation: AAK31328.1.
AF397453 mRNA. Translation: AAK93971.1.
AY358085 mRNA. Translation: AAQ88452.1.
AL834187 mRNA. Translation: CAH56486.1.
EF064730 Genomic DNA. Translation: ABK41913.1.
AL353899, AL135929 Genomic DNA. Translation: CAH71427.1.
BC101066 mRNA. Translation: AAI01067.1.
BC101067 mRNA. Translation: AAI01068.1.
BC101069 mRNA. Translation: AAI01070.1.
CCDSiCCDS1165.1. [Q96RD9-1]
RefSeqiNP_001182317.1. NM_001195388.1.
NP_112571.2. NM_031281.2. [Q96RD9-1]
UniGeneiHs.415950.

Genome annotation databases

EnsembliENST00000361835; ENSP00000354691; ENSG00000143297. [Q96RD9-1]
ENST00000368188; ENSP00000357171; ENSG00000143297. [Q96RD9-2]
ENST00000368189; ENSP00000357172; ENSG00000143297. [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297. [Q96RD9-3]
GeneIDi83416.
KEGGihsa:83416.
UCSCiuc001fqu.3. human. [Q96RD9-1]
uc001fqv.1. human. [Q96RD9-4]
uc010phv.1. human. [Q96RD9-3]

Polymorphism databases

DMDMi296439341.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF369794 mRNA. Translation: AAK50059.2 .
AF343662 mRNA. Translation: AAK31325.1 .
AF343663 mRNA. Translation: AAK31326.1 .
AF343664 mRNA. Translation: AAK31327.1 .
AF343665 mRNA. Translation: AAK31328.1 .
AF397453 mRNA. Translation: AAK93971.1 .
AY358085 mRNA. Translation: AAQ88452.1 .
AL834187 mRNA. Translation: CAH56486.1 .
EF064730 Genomic DNA. Translation: ABK41913.1 .
AL353899 , AL135929 Genomic DNA. Translation: CAH71427.1 .
BC101066 mRNA. Translation: AAI01067.1 .
BC101067 mRNA. Translation: AAI01068.1 .
BC101069 mRNA. Translation: AAI01070.1 .
CCDSi CCDS1165.1. [Q96RD9-1 ]
RefSeqi NP_001182317.1. NM_001195388.1.
NP_112571.2. NM_031281.2. [Q96RD9-1 ]
UniGenei Hs.415950.

3D structure databases

ProteinModelPortali Q96RD9.
SMRi Q96RD9. Positions 21-281, 344-731.
ModBasei Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000354691.

Protein family/group databases

MEROPSi I43.001.

PTM databases

PhosphoSitei Q96RD9.

Polymorphism databases

DMDMi 296439341.

Proteomic databases

PaxDbi Q96RD9.
PRIDEi Q96RD9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361835 ; ENSP00000354691 ; ENSG00000143297 . [Q96RD9-1 ]
ENST00000368188 ; ENSP00000357171 ; ENSG00000143297 . [Q96RD9-2 ]
ENST00000368189 ; ENSP00000357172 ; ENSG00000143297 . [Q96RD9-4 ]
ENST00000368190 ; ENSP00000357173 ; ENSG00000143297 . [Q96RD9-3 ]
GeneIDi 83416.
KEGGi hsa:83416.
UCSCi uc001fqu.3. human. [Q96RD9-1 ]
uc001fqv.1. human. [Q96RD9-4 ]
uc010phv.1. human. [Q96RD9-3 ]

Organism-specific databases

CTDi 83416.
GeneCardsi GC01M157477.
HGNCi HGNC:18508. FCRL5.
HPAi HPA039998.
MIMi 605877. gene.
neXtProti NX_Q96RD9.
PharmGKBi PA142671769.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG151212.
HOVERGENi HBG074073.
KOi K06727.
OMAi CERGASI.
OrthoDBi EOG7BP81V.
PhylomeDBi Q96RD9.
TreeFami TF351107.

Miscellaneous databases

GeneWikii FCRL5.
GenomeRNAii 83416.
NextBioi 72304.
PROi Q96RD9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96RD9.
Bgeei Q96RD9.
CleanExi HS_FCRL5.
Genevestigatori Q96RD9.

Family and domain databases

Gene3Di 2.60.40.10. 9 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view ]
SMARTi SM00409. IG. 7 hits.
SM00408. IGc2. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 8 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "BXMAS1 identifies a cluster of homologous genes differentially expressed in B cells."
    Nakayama Y., Weissman S.M., Bothwell A.L.M.
    Biochem. Biophys. Res. Commun. 285:830-837(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS HIS-267; ASP-418 AND ILE-466.
  2. "IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy."
    Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R.
    Immunity 14:277-289(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY, DISEASE, VARIANTS HIS-267; ASP-418 AND ILE-466.
  3. "Identification of a family of Fc receptor homologs with preferential B cell expression."
    Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
    Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-267; ILE-269; ASP-418 AND ILE-466.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lymph node.
  6. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-267; ASP-418 AND ILE-466.
  7. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-269; ASP-418 AND ILE-466.
  9. "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
    Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
    Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  10. "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
    Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
    Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  11. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-687.

Entry informationi

Entry nameiFCRL5_HUMAN
AccessioniPrimary (citable) accession number: Q96RD9
Secondary accession number(s): A0N0M2
, B7WNT9, B7WP94, Q495Q2, Q495Q4, Q5VYK9, Q6UY46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi