Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96RD9 (FCRL5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fc receptor-like protein 5

Short name=FcR-like protein 5
Short name=FcRL5
Alternative name(s):
BXMAS1
Fc receptor homolog 5
Short name=FcRH5
Immune receptor translocation-associated protein 2
CD_antigen=CD307e
Gene names
Name:FCRL5
Synonyms:FCRH5, IRTA2
ORF Names:UNQ503/PRO820
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length977 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in B-cell development and differentiation in peripheral lymphoid organs and may be useful markers of B-cell stages. May have an immunoregulatory role in marginal zone B-cells. Ref.1

Subcellular location

Cell membrane; Single-pass type I membrane protein Ref.10.

Tissue specificity

Expressed in marginal zone B-cells, immunoblasts, tonsillar germinal center centrocytes and in the intraepithelial and interfollicular regions of the tonsil. Expressed in many lymphoma cell lines and on hairy cell leukemia cells. Isoform 1, isoform 3, isoform 4 and isoform 5 are detected in lymph node, spleen, bone marrow, and small intestine with preponderance of isoform 3. Expressed in mature and memory B-cells and down-regulated in germinal center cells (at protein level). Ref.2 Ref.9 Ref.10

Domain

Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM) By similarity.

Involvement in disease

A chromosomal aberration involving FCRL5 has been found in cell lines with 1q21 abnormalities derived from Burkitt lymphoma. Duplication dup1(q21q32). Ref.2

Sequence similarities

Contains 8 Ig-like C2-type (immunoglobulin-like) domains.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96RD9-1)

Also known as: IRTA2c;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96RD9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     103-124: ASLILQAPLSVFEGDSVVLRCR → EMGFPHAAQANVELLGSSDLLT
     125-977: Missing.
Isoform 3 (identifier: Q96RD9-3)

Also known as: IRTA2a;

The sequence of this isoform differs from the canonical sequence as follows:
     747-759: VPVSRPVLTLRAP → GEWALPTSSTSEN
     760-977: Missing.
Isoform 4 (identifier: Q96RD9-4)

Also known as: IRTA2b;

The sequence of this isoform differs from the canonical sequence as follows:
     561-592: VPVSRPILTLRVPRAQAVVGDLLELHCEAPRG → GKCWVLASHPPLAEFSLTHSFKNLFALSSFLP
     593-977: Missing.
Isoform 5 (identifier: Q96RD9-5)

Also known as: IRTA2d;

The sequence of this isoform differs from the canonical sequence as follows:
     152-152: H → Q
     153-977: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1515 Potential
Chain16 – 977962Fc receptor-like protein 5
PRO_0000225622

Regions

Topological domain16 – 851836Extracellular Potential
Transmembrane852 – 87221Helical; Potential
Topological domain873 – 977105Cytoplasmic Potential
Domain23 – 10179Ig-like C2-type 1
Domain188 – 27184Ig-like C2-type 2
Domain287 – 37488Ig-like C2-type 3
Domain380 – 46384Ig-like C2-type 4
Domain473 – 55684Ig-like C2-type 5
Domain566 – 65186Ig-like C2-type 6
Domain659 – 74486Ig-like C2-type 7
Domain752 – 83483Ig-like C2-type 8
Motif897 – 9026ITIM motif 1
Motif910 – 9156ITIM motif 2
Motif922 – 9276ITIM motif 3
Motif952 – 9576ITIM motif 4

Amino acid modifications

Glycosylation3831N-linked (GlcNAc...) Potential
Disulfide bond44 ↔ 85 By similarity
Disulfide bond211 ↔ 260 By similarity
Disulfide bond308 ↔ 355 By similarity
Disulfide bond401 ↔ 448 By similarity
Disulfide bond494 ↔ 541 By similarity
Disulfide bond587 ↔ 634 By similarity
Disulfide bond680 ↔ 727 By similarity
Disulfide bond773 ↔ 819 By similarity

Natural variations

Alternative sequence103 – 12422ASLIL…VLRCR → EMGFPHAAQANVELLGSSDL LT in isoform 2.
VSP_017379
Alternative sequence125 – 977853Missing in isoform 2.
VSP_017380
Alternative sequence1521H → Q in isoform 5.
VSP_017381
Alternative sequence153 – 977825Missing in isoform 5.
VSP_017382
Alternative sequence561 – 59232VPVSR…EAPRG → GKCWVLASHPPLAEFSLTHS FKNLFALSSFLP in isoform 4.
VSP_017383
Alternative sequence593 – 977385Missing in isoform 4.
VSP_017384
Alternative sequence747 – 75913VPVSR…TLRAP → GEWALPTSSTSEN in isoform 3.
VSP_017385
Alternative sequence760 – 977218Missing in isoform 3.
VSP_017386
Natural variant2671Y → H. Ref.1 Ref.2 Ref.3 Ref.6
Corresponds to variant rs6679793 [ dbSNP | Ensembl ].
VAR_025447
Natural variant2691V → I. Ref.3 Ref.8
Corresponds to variant rs12036228 [ dbSNP | Ensembl ].
VAR_025448
Natural variant4181G → D. Ref.1 Ref.2 Ref.3 Ref.6 Ref.8
Corresponds to variant rs2012199 [ dbSNP | Ensembl ].
VAR_025449
Natural variant4271N → K.
Corresponds to variant rs16838748 [ dbSNP | Ensembl ].
VAR_056044
Natural variant4571Q → R.
Corresponds to variant rs34868810 [ dbSNP | Ensembl ].
VAR_056045
Natural variant4661V → I. Ref.1 Ref.2 Ref.3 Ref.6 Ref.8
Corresponds to variant rs6427384 [ dbSNP | Ensembl ].
VAR_025450
Natural variant6871S → C in a breast cancer sample; somatic mutation. Ref.11
VAR_035514

Experimental info

Sequence conflict7331L → P in AAK50059. Ref.1
Sequence conflict8901S → P in AAK50059. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (IRTA2c) [UniParc].

Last modified May 18, 2010. Version 3.
Checksum: 9545DA1B6A164FDD

FASTA977106,437
        10         20         30         40         50         60 
MLLWVILLVL APVSGQFART PRPIIFLQPP WTTVFQGERV TLTCKGFRFY SPQKTKWYHR 

        70         80         90        100        110        120 
YLGKEILRET PDNILEVQES GEYRCQAQGS PLSSPVHLDF SSASLILQAP LSVFEGDSVV 

       130        140        150        160        170        180 
LRCRAKAEVT LNNTIYKNDN VLAFLNKRTD FHIPHACLKD NGAYRCTGYK ESCCPVSSNT 

       190        200        210        220        230        240 
VKIQVQEPFT RPVLRASSFQ PISGNPVTLT CETQLSLERS DVPLRFRFFR DDQTLGLGWS 

       250        260        270        280        290        300 
LSPNFQITAM WSKDSGFYWC KAATMPYSVI SDSPRSWIQV QIPASHPVLT LSPEKALNFE 

       310        320        330        340        350        360 
GTKVTLHCET QEDSLRTLYR FYHEGVPLRH KSVRCERGAS ISFSLTTENS GNYYCTADNG 

       370        380        390        400        410        420 
LGAKPSKAVS LSVTVPVSHP VLNLSSPEDL IFEGAKVTLH CEAQRGSLPI LYQFHHEGAA 

       430        440        450        460        470        480 
LERRSANSAG GVAISFSLTA EHSGNYYCTA DNGFGPQRSK AVSLSVTVPV SHPVLTLSSA 

       490        500        510        520        530        540 
EALTFEGATV TLHCEVQRGS PQILYQFYHE DMPLWSSSTP SVGRVSFSFS LTEGHSGNYY 

       550        560        570        580        590        600 
CTADNGFGPQ RSEVVSLFVT VPVSRPILTL RVPRAQAVVG DLLELHCEAP RGSPPILYWF 

       610        620        630        640        650        660 
YHEDVTLGSS SAPSGGEASF NLSLTAEHSG NYSCEANNGL VAQHSDTISL SVIVPVSRPI 

       670        680        690        700        710        720 
LTFRAPRAQA VVGDLLELHC EALRGSSPIL YWFYHEDVTL GKISAPSGGG ASFNLSLTTE 

       730        740        750        760        770        780 
HSGIYSCEAD NGLEAQRSEM VTLKVAVPVS RPVLTLRAPG THAAVGDLLE LHCEALRGSP 

       790        800        810        820        830        840 
LILYRFFHED VTLGNRSSPS GGASLNLSLT AEHSGNYSCE ADNGLGAQRS ETVTLYITGL 

       850        860        870        880        890        900 
TANRSGPFAT GVAGGLLSIA GLAAGALLLY CWLSRKAGRK PASDPARSPS DSDSQEPTYH 

       910        920        930        940        950        960 
NVPAWEELQP VYTNANPRGE NVVYSEVRII QEKKKHAVAS DPRHLRNKGS PIIYSEVKVA 

       970 
STPVSGSLFL ASSAPHR 

« Hide

Isoform 2 [UniParc].

Checksum: D7915849A385455D
Show »

FASTA12414,080
Isoform 3 (IRTA2a) [UniParc].

Checksum: 11903D6E89081BC9
Show »

FASTA75983,293
Isoform 4 (IRTA2b) [UniParc].

Checksum: D99E9511BC528621
Show »

FASTA59265,617
Isoform 5 (IRTA2d) [UniParc].

Checksum: 0437E9CBE8D3792C
Show »

FASTA15217,377

References

« Hide 'large scale' references
[1]"BXMAS1 identifies a cluster of homologous genes differentially expressed in B cells."
Nakayama Y., Weissman S.M., Bothwell A.L.M.
Biochem. Biophys. Res. Commun. 285:830-837(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANTS HIS-267; ASP-418 AND ILE-466.
[2]"IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy."
Hatzivassiliou G., Miller I., Takizawa J., Palanisamy N., Rao P.H., Iida S., Tagawa S., Taniwaki M., Russo J., Neri A., Cattoretti G., Clynes R., Mendelsohn C., Chaganti R.S.K., Dalla-Favera R.
Immunity 14:277-289(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3; 4 AND 5), TISSUE SPECIFICITY, DISEASE, VARIANTS HIS-267; ASP-418 AND ILE-466.
[3]"Identification of a family of Fc receptor homologs with preferential B cell expression."
Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS HIS-267; ILE-269; ASP-418 AND ILE-466.
[4]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Lymph node.
[6]Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.
Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS HIS-267; ASP-418 AND ILE-466.
[7]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ILE-269; ASP-418 AND ILE-466.
[9]"IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[10]"Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[11]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-687.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF369794 mRNA. Translation: AAK50059.2.
AF343662 mRNA. Translation: AAK31325.1.
AF343663 mRNA. Translation: AAK31326.1.
AF343664 mRNA. Translation: AAK31327.1.
AF343665 mRNA. Translation: AAK31328.1.
AF397453 mRNA. Translation: AAK93971.1.
AY358085 mRNA. Translation: AAQ88452.1.
AL834187 mRNA. Translation: CAH56486.1.
EF064730 Genomic DNA. Translation: ABK41913.1.
AL353899, AL135929 Genomic DNA. Translation: CAH71427.1.
BC101066 mRNA. Translation: AAI01067.1.
BC101067 mRNA. Translation: AAI01068.1.
BC101069 mRNA. Translation: AAI01070.1.
RefSeqNP_001182317.1. NM_001195388.1.
NP_112571.2. NM_031281.2.
UniGeneHs.415950.

3D structure databases

ProteinModelPortalQ96RD9.
SMRQ96RD9. Positions 21-281, 288-731, 758-794.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000354691.

Protein family/group databases

MEROPSI43.001.

PTM databases

PhosphoSiteQ96RD9.

Polymorphism databases

DMDM296439341.

Proteomic databases

PaxDbQ96RD9.
PRIDEQ96RD9.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000361835; ENSP00000354691; ENSG00000143297. [Q96RD9-1]
ENST00000368188; ENSP00000357171; ENSG00000143297. [Q96RD9-2]
ENST00000368189; ENSP00000357172; ENSG00000143297. [Q96RD9-4]
ENST00000368190; ENSP00000357173; ENSG00000143297. [Q96RD9-3]
GeneID83416.
KEGGhsa:83416.
UCSCuc001fqu.3. human. [Q96RD9-1]
uc001fqv.1. human. [Q96RD9-4]
uc010phv.1. human. [Q96RD9-3]

Organism-specific databases

CTD83416.
GeneCardsGC01M157477.
HGNCHGNC:18508. FCRL5.
HPAHPA039998.
MIM605877. gene.
neXtProtNX_Q96RD9.
PharmGKBPA142671769.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG151212.
HOVERGENHBG074073.
KOK06727.
OMACERGASI.
OrthoDBEOG7BP81V.
PhylomeDBQ96RD9.
TreeFamTF351107.

Gene expression databases

ArrayExpressQ96RD9.
BgeeQ96RD9.
CleanExHS_FCRL5.
GenevestigatorQ96RD9.

Family and domain databases

Gene3D2.60.40.10. 9 hits.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
SMARTSM00409. IG. 7 hits.
SM00408. IGc2. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 8 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiFCRL5.
GenomeRNAi83416.
NextBio72304.
PROQ96RD9.
SOURCESearch...

Entry information

Entry nameFCRL5_HUMAN
AccessionPrimary (citable) accession number: Q96RD9
Secondary accession number(s): A0N0M2 expand/collapse secondary AC list , B7WNT9, B7WP94, Q495Q2, Q495Q4, Q5VYK9, Q6UY46
Entry history
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: May 18, 2010
Last modified: April 16, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries