Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Pannexin-2

Gene

PANX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Structural component of the gap junctions and the hemichannels.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-112303. Electric Transmission Across Gap Junctions.

Protein family/group databases

TCDBi1.A.25.2.2. the gap junction-forming innexin (innexin) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Pannexin-2
Gene namesi
Name:PANX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:8600. PANX2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini11 – 4737CytoplasmicSequence analysisAdd
BLAST
Transmembranei48 – 7023HelicalPROSITE-ProRule annotationAdd
BLAST
Topological domaini71 – 12353ExtracellularSequence analysisAdd
BLAST
Transmembranei124 – 14623HelicalPROSITE-ProRule annotationAdd
BLAST
Topological domaini147 – 22680CytoplasmicSequence analysisAdd
BLAST
Transmembranei227 – 24923HelicalPROSITE-ProRule annotationAdd
BLAST
Topological domaini250 – 29243ExtracellularSequence analysisAdd
BLAST
Transmembranei293 – 31523HelicalPROSITE-ProRule annotationAdd
BLAST
Topological domaini316 – 643328CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Gap junction, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA32930.

Polymorphism and mutation databases

BioMutaiPANX2.
DMDMi296439257.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 677677Pannexin-2PRO_0000208488Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi86 – 861N-linked (GlcNAc...)Sequence analysis
Modified residuei593 – 5931PhosphoserineBy similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ96RD6.
PeptideAtlasiQ96RD6.
PRIDEiQ96RD6.

PTM databases

iPTMnetiQ96RD6.
PhosphoSiteiQ96RD6.

Expressioni

Gene expression databases

BgeeiENSG00000073150.
CleanExiHS_PANX2.
ExpressionAtlasiQ96RD6. baseline and differential.
GenevisibleiQ96RD6. HS.

Organism-specific databases

HPAiHPA039117.

Interactioni

Subunit structurei

Forms PANX1/PANX2-heteromeric intercellular channels on coexpression in paired Xenopus oocytes. Does not form homomeric channels (By similarity).By similarity

Protein-protein interaction databases

IntActiQ96RD6. 1 interaction.
STRINGi9606.ENSP00000379183.

Structurei

3D structure databases

ProteinModelPortaliQ96RD6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the pannexin family.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGKS. Eukaryota.
ENOG4110P9D. LUCA.
GeneTreeiENSGT00390000009703.
HOGENOMiHOG000082414.
HOVERGENiHBG053498.
InParanoidiQ96RD6.
KOiK03443.
OMAiRAAHHYK.
OrthoDBiEOG091G086D.
PhylomeDBiQ96RD6.
TreeFamiTF333142.

Family and domain databases

InterProiIPR000990. Innexin.
[Graphical view]
PfamiPF00876. Innexin. 1 hit.
[Graphical view]
PROSITEiPS51013. PANNEXIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q96RD6-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHHLLEQSAD MATALLAGEK LRELILPGAQ DDKAGALAAL LLQLKLELPF
60 70 80 90 100
DRVVTIGTVL VPILLVTLVF TKNFAEEPIY CYTPHNFTRD QALYARGYCW
110 120 130 140 150
TELRDALPGV DASLWPSLFE HKFLPYALLA FAAIMYVPAL GWEFLASTRL
160 170 180 190 200
TSELNFLLQE IDNCYHRAAE GRAPKIEKQI QSKGPGITER EKREIIENAE
210 220 230 240 250
KEKSPEQNLF EKYLERRGRS NFLAKLYLAR HVLILLLSAV PISYLCTYYA
260 270 280 290 300
TQKQNEFTCA LGASPDGAAG AGPAVRVSCK LPSVQLQRII AGVDIVLLCV
310 320 330 340 350
MNLIILVNLI HLFIFRKSNF IFDKLHKVGI KTRRQWRRSQ FCDINILAMF
360 370 380 390 400
CNENRDHIKS LNRLDFITNE SDLMYDNVVR QLLAALAQSN HDATPTVRDS
410 420 430 440 450
GVQTVDPSAN PAEPDGAAEP PVVKRPRKKM KWIPTSNPLP QPFKEPLAIM
460 470 480 490 500
RVENSKAEKP KPARRKTATD TLIAPLLDRS AHHYKGGGGD PGPGPAPAPA
510 520 530 540 550
PPPAPDKKHA RHFSLDVHPY ILGTKKAKAE AVPAALPASR SQEGGFLSQA
560 570 580 590 600
EDCGLGLAPA PIKDAPLPEK EIPYPTEPAR AGLPSGGPFH VRSPPAAPAV
610 620 630 640 650
APLTPASLGK AEPLTILSRN ATHPLLHINT LYEAREEEDG GPRLPQDVGD
660 670
LIAIPAPQQI LIATFDEPRT VVSTVEF
Length:677
Mass (Da):74,447
Last modified:May 18, 2010 - v2
Checksum:iE15C741192B1BD46
GO
Isoform 1 (identifier: Q96RD6-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:643
Mass (Da):70,641
Checksum:iBFD3E97C92D8ED86
GO
Isoform 2 (identifier: Q96RD6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-134: Missing.
     632-677: YEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF → SSSPPSTSRERS

Show »
Length:509
Mass (Da):55,733
Checksum:i1AB66CD9F2F6FAC2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti147 – 1471S → F in a breast cancer sample; somatic mutation. 1 Publication
VAR_036575

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 134134Missing in isoform 2. 1 PublicationVSP_039092Add
BLAST
Alternative sequencei632 – 67746YEARE…STVEF → SSSPPSTSRERS in isoform 1 and isoform 2. 1 PublicationVSP_002677Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398510 mRNA. Translation: AAK91715.1.
AF398511 mRNA. Translation: AAK91716.1.
AK299910 mRNA. Translation: BAH13170.1.
AL022328 Genomic DNA. No translation available.
CCDSiCCDS14085.2. [Q96RD6-3]
CCDS54544.1. [Q96RD6-1]
RefSeqiNP_001153772.1. NM_001160300.1. [Q96RD6-1]
NP_443071.2. NM_052839.3. [Q96RD6-3]
UniGeneiHs.440092.

Genome annotation databases

EnsembliENST00000159647; ENSP00000159647; ENSG00000073150. [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150. [Q96RD6-3]
GeneIDi56666.
KEGGihsa:56666.
UCSCiuc003bjn.5. human. [Q96RD6-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Pannexin entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF398510 mRNA. Translation: AAK91715.1.
AF398511 mRNA. Translation: AAK91716.1.
AK299910 mRNA. Translation: BAH13170.1.
AL022328 Genomic DNA. No translation available.
CCDSiCCDS14085.2. [Q96RD6-3]
CCDS54544.1. [Q96RD6-1]
RefSeqiNP_001153772.1. NM_001160300.1. [Q96RD6-1]
NP_443071.2. NM_052839.3. [Q96RD6-3]
UniGeneiHs.440092.

3D structure databases

ProteinModelPortaliQ96RD6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ96RD6. 1 interaction.
STRINGi9606.ENSP00000379183.

Protein family/group databases

TCDBi1.A.25.2.2. the gap junction-forming innexin (innexin) family.

PTM databases

iPTMnetiQ96RD6.
PhosphoSiteiQ96RD6.

Polymorphism and mutation databases

BioMutaiPANX2.
DMDMi296439257.

Proteomic databases

PaxDbiQ96RD6.
PeptideAtlasiQ96RD6.
PRIDEiQ96RD6.

Protocols and materials databases

DNASUi56666.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000159647; ENSP00000159647; ENSG00000073150. [Q96RD6-1]
ENST00000395842; ENSP00000379183; ENSG00000073150. [Q96RD6-3]
GeneIDi56666.
KEGGihsa:56666.
UCSCiuc003bjn.5. human. [Q96RD6-3]

Organism-specific databases

CTDi56666.
GeneCardsiPANX2.
H-InvDBHIX0016605.
HGNCiHGNC:8600. PANX2.
HPAiHPA039117.
MIMi608421. gene.
neXtProtiNX_Q96RD6.
PharmGKBiPA32930.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGKS. Eukaryota.
ENOG4110P9D. LUCA.
GeneTreeiENSGT00390000009703.
HOGENOMiHOG000082414.
HOVERGENiHBG053498.
InParanoidiQ96RD6.
KOiK03443.
OMAiRAAHHYK.
OrthoDBiEOG091G086D.
PhylomeDBiQ96RD6.
TreeFamiTF333142.

Enzyme and pathway databases

ReactomeiR-HSA-112303. Electric Transmission Across Gap Junctions.

Miscellaneous databases

ChiTaRSiPANX2. human.
GenomeRNAii56666.
PROiQ96RD6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000073150.
CleanExiHS_PANX2.
ExpressionAtlasiQ96RD6. baseline and differential.
GenevisibleiQ96RD6. HS.

Family and domain databases

InterProiIPR000990. Innexin.
[Graphical view]
PfamiPF00876. Innexin. 1 hit.
[Graphical view]
PROSITEiPS51013. PANNEXIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPANX2_HUMAN
AccessioniPrimary (citable) accession number: Q96RD6
Secondary accession number(s): B7Z684, Q96RD5, Q9UGX8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.