Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UAP56-interacting factor

Gene

FYTTD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for mRNA export from the nucleus to the cytoplasm. Acts as an adapter that uses the DDX39B/UAP56-NFX1 pathway to ensure efficient mRNA export and delivering to the nuclear pore. Associates with spliced and unspliced mRNAs simultaneously with ALYREF/THOC4.1 Publication

GO - Molecular functioni

  • mRNA binding Source: UniProtKB
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

  • mRNA export from nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

mRNA transport, Transport

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122068-MONOMER.
ReactomeiR-HSA-109688. Cleavage of Growing Transcript in the Termination Region.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-72187. mRNA 3'-end processing.

Names & Taxonomyi

Protein namesi
Recommended name:
UAP56-interacting factor
Alternative name(s):
Forty-two-three domain-containing protein 1
Short name:
Protein 40-2-3
Gene namesi
Name:FYTTD1
Synonyms:UIF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:25407. FYTTD1.

Subcellular locationi

GO - Cellular componenti

  • nuclear speck Source: UniProtKB
  • nucleoplasm Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000122068.
PharmGKBiPA134946373.

Polymorphism and mutation databases

BioMutaiFYTTD1.
DMDMi284018159.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002874411 – 318UAP56-interacting factorAdd BLAST318

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei14PhosphothreonineBy similarity1
Modified residuei16PhosphoserineCombined sources1
Modified residuei23PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
Modified residuei118PhosphoserineCombined sources1
Cross-linki140Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)
Cross-linki261Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96QD9.
MaxQBiQ96QD9.
PaxDbiQ96QD9.
PeptideAtlasiQ96QD9.
PRIDEiQ96QD9.
TopDownProteomicsiQ96QD9-1. [Q96QD9-1]

PTM databases

iPTMnetiQ96QD9.
PhosphoSitePlusiQ96QD9.

Expressioni

Tissue specificityi

Expressed in a wide variety of cancer types.1 Publication

Gene expression databases

BgeeiENSG00000122068.
CleanExiHS_FYTTD1.
ExpressionAtlasiQ96QD9. baseline and differential.
GenevisibleiQ96QD9. HS.

Organism-specific databases

HPAiHPA054474.

Interactioni

Subunit structurei

Interacts with CHTOP (By similarity). Interacts with DDX39B/UAP56 and NXF1; interaction with DDX39B/UAP56 and NXF1 are mutually exclusive. Interacts with SSRP1; required for its recruitment to mRNAs.By similarity1 Publication

Protein-protein interaction databases

BioGridi123976. 70 interactors.
IntActiQ96QD9. 16 interactors.
MINTiMINT-1379576.
STRINGi9606.ENSP00000241502.

Structurei

3D structure databases

ProteinModelPortaliQ96QD9.
SMRiQ96QD9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi26 – 44UAP56-binding motifAdd BLAST19

Sequence similaritiesi

Belongs to the UIF family.Curated

Phylogenomic databases

eggNOGiENOG410II12. Eukaryota.
ENOG4111TUX. LUCA.
GeneTreeiENSGT00390000012807.
HOVERGENiHBG066549.
InParanoidiQ96QD9.
OMAiMKRDQSE.
OrthoDBiEOG091G0GRX.
PhylomeDBiQ96QD9.
TreeFamiTF336232.

Family and domain databases

InterProiIPR009782. FYTTD1.
[Graphical view]
PANTHERiPTHR21038. PTHR21038. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96QD9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNRFGTRLVG ATATSSPPPK ARSNENLDKI DMSLDDIIKL NRKEGKKQNF
60 70 80 90 100
PRLNRRLLQQ SGAQQFRMRV RWGIQQNSGF GKTSLNRRGR VMPGKRRPNG
110 120 130 140 150
VITGLAARKT TGIRKGISPM NRPPLSDKNI EQYFPVLKRK ANLLRQNEGQ
160 170 180 190 200
RKPVAVLKRP SQLSRKNNIP ANFTRSGNKL NHQKDTRQAT FLFRRGLKVQ
210 220 230 240 250
AQLNTEQLLD DVVAKRTRQW RTSTTNGGIL TVSIDNPGAV QCPVTQKPRL
260 270 280 290 300
TRTAVPSFLT KREQSDVKKV PKGVPLQFDI NSVGKQTGMT LNERFGILKE
310
QRATLTYNKG GSRFVTVG
Length:318
Mass (Da):35,818
Last modified:January 19, 2010 - v3
Checksum:iEB2F37D1D423D13C
GO
Isoform 2 (identifier: Q96QD9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MNRFGTRLVGATATSSPPPKARSNENLDKIDMSLD → MEPSVIMGN

Note: No experimental confirmation available.
Show »
Length:292
Mass (Da):33,004
Checksum:iE6E22D967F234F82
GO
Isoform 3 (identifier: Q96QD9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Note: No experimental confirmation available.
Show »
Length:251
Mass (Da):28,182
Checksum:i893BA69046662EA4
GO
Isoform 4 (identifier: Q96QD9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: N → K
     130-318: Missing.

Note: No experimental confirmation available.
Show »
Length:129
Mass (Da):14,524
Checksum:iDD28E3E18E6D18F9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti178N → S in BAH14679 (PubMed:14702039).Curated1
Sequence conflicti263E → G in BAB55284 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06241187R → H.4 PublicationsCorresponds to variant rs3205525dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0386581 – 67Missing in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_0386591 – 35MNRFG…DMSLD → MEPSVIMGN in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_038660129N → K in isoform 4. 1 Publication1
Alternative sequenceiVSP_038661130 – 318Missing in isoform 4. 1 PublicationAdd BLAST189

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ344094 mRNA. Translation: CAC51432.1.
AL136558 mRNA. Translation: CAB66493.1.
AK027672 mRNA. Translation: BAB55284.1.
AK296283 mRNA. Translation: BAH12300.1.
AK302546 mRNA. Translation: BAH13737.1.
AK303462 mRNA. Translation: BAH13966.1.
AK315019 mRNA. Translation: BAG37509.1.
AK316308 mRNA. Translation: BAH14679.1.
CR533502 mRNA. Translation: CAG38533.1.
AC024560 Genomic DNA. No translation available.
AC055764 Genomic DNA. No translation available.
CH471252 Genomic DNA. Translation: EAW92240.1.
BC035006 mRNA. Translation: AAH35006.1.
BC039734 mRNA. Translation: AAH39734.1.
CCDSiCCDS3329.1. [Q96QD9-1]
CCDS43196.2. [Q96QD9-2]
RefSeqiNP_001011537.2. NM_001011537.2. [Q96QD9-2]
NP_115664.2. NM_032288.6. [Q96QD9-1]
UniGeneiHs.277533.

Genome annotation databases

EnsembliENST00000241502; ENSP00000241502; ENSG00000122068. [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068. [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068. [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068. [Q96QD9-3]
GeneIDi84248.
KEGGihsa:84248.
UCSCiuc003fyi.3. human. [Q96QD9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ344094 mRNA. Translation: CAC51432.1.
AL136558 mRNA. Translation: CAB66493.1.
AK027672 mRNA. Translation: BAB55284.1.
AK296283 mRNA. Translation: BAH12300.1.
AK302546 mRNA. Translation: BAH13737.1.
AK303462 mRNA. Translation: BAH13966.1.
AK315019 mRNA. Translation: BAG37509.1.
AK316308 mRNA. Translation: BAH14679.1.
CR533502 mRNA. Translation: CAG38533.1.
AC024560 Genomic DNA. No translation available.
AC055764 Genomic DNA. No translation available.
CH471252 Genomic DNA. Translation: EAW92240.1.
BC035006 mRNA. Translation: AAH35006.1.
BC039734 mRNA. Translation: AAH39734.1.
CCDSiCCDS3329.1. [Q96QD9-1]
CCDS43196.2. [Q96QD9-2]
RefSeqiNP_001011537.2. NM_001011537.2. [Q96QD9-2]
NP_115664.2. NM_032288.6. [Q96QD9-1]
UniGeneiHs.277533.

3D structure databases

ProteinModelPortaliQ96QD9.
SMRiQ96QD9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123976. 70 interactors.
IntActiQ96QD9. 16 interactors.
MINTiMINT-1379576.
STRINGi9606.ENSP00000241502.

PTM databases

iPTMnetiQ96QD9.
PhosphoSitePlusiQ96QD9.

Polymorphism and mutation databases

BioMutaiFYTTD1.
DMDMi284018159.

Proteomic databases

EPDiQ96QD9.
MaxQBiQ96QD9.
PaxDbiQ96QD9.
PeptideAtlasiQ96QD9.
PRIDEiQ96QD9.
TopDownProteomicsiQ96QD9-1. [Q96QD9-1]

Protocols and materials databases

DNASUi84248.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000241502; ENSP00000241502; ENSG00000122068. [Q96QD9-1]
ENST00000415708; ENSP00000393746; ENSG00000122068. [Q96QD9-2]
ENST00000418169; ENSP00000400191; ENSG00000122068. [Q96QD9-4]
ENST00000424384; ENSP00000394631; ENSG00000122068. [Q96QD9-3]
GeneIDi84248.
KEGGihsa:84248.
UCSCiuc003fyi.3. human. [Q96QD9-1]

Organism-specific databases

CTDi84248.
GeneCardsiFYTTD1.
H-InvDBHIX0003990.
HGNCiHGNC:25407. FYTTD1.
HPAiHPA054474.
MIMi616933. gene.
neXtProtiNX_Q96QD9.
OpenTargetsiENSG00000122068.
PharmGKBiPA134946373.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410II12. Eukaryota.
ENOG4111TUX. LUCA.
GeneTreeiENSGT00390000012807.
HOVERGENiHBG066549.
InParanoidiQ96QD9.
OMAiMKRDQSE.
OrthoDBiEOG091G0GRX.
PhylomeDBiQ96QD9.
TreeFamiTF336232.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122068-MONOMER.
ReactomeiR-HSA-109688. Cleavage of Growing Transcript in the Termination Region.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-72187. mRNA 3'-end processing.

Miscellaneous databases

ChiTaRSiFYTTD1. human.
GenomeRNAii84248.
PROiQ96QD9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122068.
CleanExiHS_FYTTD1.
ExpressionAtlasiQ96QD9. baseline and differential.
GenevisibleiQ96QD9. HS.

Family and domain databases

InterProiIPR009782. FYTTD1.
[Graphical view]
PANTHERiPTHR21038. PTHR21038. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiUIF_HUMAN
AccessioniPrimary (citable) accession number: Q96QD9
Secondary accession number(s): A8MY74
, B2RCB2, B7Z3R4, B7Z7V1, B7Z8I0, B7ZAJ3, C9J7P6, C9JNG6, C9JTH3, C9JY50, Q96SL9, Q9BQI8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: January 19, 2010
Last modified: November 2, 2016
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.