Q96Q45 (TM237_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 68.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane protein 237 Alternative name(s): Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 408 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the transition zone in primary cilia. Required for ciliogenesis. Ref.6 |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. Cell projection › cilium. Note: Localizes at the proximal region of primary cilia were observed, consistent with localization to the transition zone. Anchored to the transition zone by RPGRIP1L. Ref.6 |
| Involvement in disease | Joubert syndrome 14 (JBTS14) [MIM:614424]: An autosomal recessive disorder characterized by severe mental retardation, hypotonia, breathing abnormalities in infancy, and dysmorphic facial features. Neuroradiologically, it is characterized by cerebellar vermian hypoplasia/aplasia, thickened and reoriented superior cerebellar peduncles, and an abnormally large interpeduncular fossa, giving the appearance of a molar tooth on transaxial slices (molar tooth sign). Additional variable features include renal disease, abnormal eye movements, and postaxial polydactyly. |
| Sequence similarities | Belongs to the TMEM237 family. |
| Sequence caution | The sequence AAY14694.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence AAY15056.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cilium biogenesis/degradation |
| Cellular component | Cell projection Cilium Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Ciliopathy Joubert syndrome |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cilium assembly Inferred from mutant phenotype Ref.6. Source: UniProtKB regulation of Wnt receptor signaling pathwayInferred from mutant phenotype Ref.6. Source: UniProtKB |
| Cellular_component | ciliary transition zone Inferred from direct assay Ref.6. Source: UniProtKB integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96Q45-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96Q45-2) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MRTDSGARLEEGHL → MGKNPV | ||||||
| Isoform 3 (identifier: Q96Q45-3) The sequence of this isoform differs from the canonical sequence as follows: 1-14: MRTDSGARLEEGHL → MTHCACARDRAREGWGARCLGARRPPRPAKRRMGKNPV | ||||||
| Isoform 4 (identifier: Q96Q45-4) The sequence of this isoform differs from the canonical sequence as follows: 36-130: Missing. | ||||||
| Isoform 5 (identifier: Q96Q45-5) The sequence of this isoform differs from the canonical sequence as follows: 132-132: K → KRPYYR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 408 | 408 | Transmembrane protein 237 | PRO_0000076169 | |||||
Regions | |||||||||
| Transmembrane | 227 – 247 | 21 | Helical; Potential | ||||||
| Transmembrane | 268 – 288 | 21 | Helical; Potential | ||||||
| Transmembrane | 303 – 323 | 21 | Helical; Potential | ||||||
| Transmembrane | 358 – 378 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 14 | 14 | MRTDS…EEGHL → MGKNPV in isoform 2. | VSP_016628 | |||||
| Alternative sequence | 1 – 14 | 14 | MRTDS…EEGHL → MTHCACARDRAREGWGARCL GARRPPRPAKRRMGKNPV in isoform 3. | VSP_042381 | |||||
| Alternative sequence | 36 – 130 | 95 | Missing in isoform 4. | VSP_042382 | |||||
| Alternative sequence | 132 | 1 | K → KRPYYR in isoform 5. | VSP_042383 | |||||
| Natural variant | 155 | 1 | D → A Found at heterozygosity in a patient with Bardet-Biedl syndrome also carrying BBS6 mutation A-57 in MKKS; hypomorphic variant. Ref.6 | VAR_067019 | |||||
Experimental info | |||||||||
| Sequence conflict | 20 | 1 | L → I in AAH29611. Ref.4 | ||||||
| Sequence conflict | 118 | 1 | P → Q in AAH29611. Ref.4 | ||||||
| Sequence conflict | 158 | 1 | T → A in BAG64880. Ref.2 | ||||||
| Sequence conflict | 215 | 1 | R → I in AAH29611. Ref.4 | ||||||
| Sequence conflict | 261 | 1 | L → I in AAH29611. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB053301 mRNA. Translation: BAB69011.1. AK090601 mRNA. Translation: BAC03487.1. AK303954 mRNA. Translation: BAG64880.1. AK304395 mRNA. Translation: BAG65230.1. AC007279 Genomic DNA. Translation: AAY15056.1. Sequence problems. AC007282 Genomic DNA. Translation: AAY14694.1. Sequence problems. BC013730 mRNA. Translation: AAH13730.1. BC029611 mRNA. Translation: AAH29611.1. BX538000 mRNA. Translation: CAD97955.1. |
| IPI | IPI00044683. IPI00658092. |
| RefSeq | NP_001037850.1. NM_001044385.2. NP_689601.2. NM_152388.3. |
| UniGene | Hs.12319. |
3D structure databases | |
| ProteinModelPortal | Q96Q45. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96Q45. 1 interaction. |
| STRING | 9606.ENSP00000380113. |
PTM databases | |
| PhosphoSite | Q96Q45. |
Polymorphism databases | |
| DMDM | 74732666. |
Proteomic databases | |
| PaxDb | Q96Q45. |
| PRIDE | Q96Q45. |
Protocols and materials databases | |
| DNASU | 65062. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000409444; ENSP00000387203; ENSG00000155755. ENST00000409883; ENSP00000386264; ENSG00000155755. |
| GeneID | 65062. |
| KEGG | hsa:65062. |
| UCSC | uc021vvd.1. human. |
Organism-specific databases | |
| CTD | 65062. |
| GeneCards | GC02M202484. |
| HGNC | HGNC:14432. TMEM237. |
| MIM | 614423. gene. 614424. phenotype. |
| neXtProt | NX_Q96Q45. |
| Orphanet | 475. Joubert syndrome. 220493. Joubert syndrome with ocular defect. 2318. Joubert syndrome with oculorenal defect. 220497. Joubert syndrome with renal defect. |
| PharmGKB | PA24745. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG71278. |
| HOGENOM | HOG000033887. |
| HOVERGEN | HBG060391. |
| InParanoid | Q96Q45. |
Gene expression databases | |
| ArrayExpress | Q96Q45. |
| Bgee | Q96Q45. |
| CleanEx | HS_ALS2CR4. |
| Genevestigator | Q96Q45. |
| GermOnline | ENSG00000155755. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 65062. |
| NextBio | 67248. |
| SOURCE | Search... |
Entry information
| Entry name | TM237_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96Q45 Secondary accession number(s): B4E1R8 Q96CY1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
