Reviewed,
UniProtKB/Swiss-Prot Q96Q40 (PFTK2_HUMAN)
Last modified
June 16, 2009.
Version 65.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Serine/threonine-protein kinase PFTAIRE-2 EC=2.7.11.22 Alternative name(s): Serine/threonine-protein kinase ALS2CR7 Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 384 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| Gene Ontology (GO) | |
| Biological process | protein amino acid phosphorylation Inferred from electronic annotation. Source: InterPro |
| Molecular function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cyclin-dependent protein kinase activityInferred from electronic annotation. Source: EC magnesium ion bindingInferred from electronic annotation. Source: UniProtKB-KW protein bindingInferred from physical interaction. Source: IntAct |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96Q40-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96Q40-2) The sequence of this isoform differs from the canonical sequence as follows: 131-151: Missing. 286-371: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96Q40-3) The sequence of this isoform differs from the canonical sequence as follows: 350-384: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 384 | 384 | Serine/threonine-protein kinase PFTAIRE-2 | PRO_0000085619 | |||||
Regions | |||||||||
| Domain | 52 – 336 | 285 | Protein kinase | ||||||
| Nucleotide binding | 58 – 66 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 173 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 81 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 131 – 151 | 21 | Missing in isoform 2. | VSP_023743 | |||||
| Alternative sequence | 286 – 371 | 86 | EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2. | VSP_023744 | |||||
| Alternative sequence | 350 – 384 | 35 | Missing in isoform 3. | VSP_023745 | |||||
| Natural variant | 13 | 1 | R → G Ref.6 | VAR_042016 | |||||
| Natural variant | 42 | 1 | K → E in a renal clear cell carcinoma sample; somatic mutation. Ref.6 | VAR_042017 | |||||
| Natural variant | 76 | 1 | Q → R Ref.6 | VAR_042018 | |||||
| Natural variant | 204 | 1 | T → I Ref.6 | VAR_042019 | |||||
| Natural variant | 225 | 1 | E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. Ref.6 | VAR_042020 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AB053308 mRNA. Translation: BAB69017.1. AK131512 mRNA. Translation: BAD18656.1. Different initiation. AC007242 Genomic DNA. Translation: AAX93182.1. AC007358 Genomic DNA. Translation: AAX88914.1. BC038807 mRNA. Translation: AAH38807.1. | |
| IPI | IPI00044678. IPI00442058. IPI00829793. |
| RefSeq | NP_631897.1. |
| UniGene | Hs.348711 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1DI8 based on UniProtKB P24941. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96Q40. 1 interaction. |
PTM databases | |
| PhosphoSite | Q96Q40. |
Proteomic databases | |
| PRIDE | Q96Q40. |
Genome annotation databases | |
| Ensembl | ENSG00000138395. Homo sapiens. [Contig view] |
| GeneID | 65061. |
| KEGG | hsa:65061. |
Organism-specific databases | |
| GeneCards | GC02P202380. |
| H-InvDB | HIX0002745. |
| HGNC | HGNC:14434. PFTK2. |
| HPA | HPA015786. |
| PharmGKB | PA24747. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q96Q40. |
| HOVERGEN | Q96Q40. |
| OMA | Q96Q40. YQLPDEE. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 247. |
Gene expression databases | |
| ArrayExpress | Q96Q40. |
| Bgee | Q96Q40. |
| CleanEx | HS_PFTK2. |
Family and domain databases | |
| InterPro | IPR000719. Prot_kinase_core. IPR017441. Protein_kinase_ATP_BS. IPR017442. Se/Thr_pkinase-rel. IPR008271. Ser_thr_pkin_AS. IPR002290. Ser_thr_pkinase. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| ProDom | PD000001. Prot_kinase. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| DrugBank | DB00171. Adenosine triphosphate. |
| NextBio | 67244. |
Entry information
| Entry name | PFTK2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96Q40 Secondary accession number(s): Q4ZG86 Q8IUP1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| SIMILARITY comments Index of protein domains and families |

Clusters with


