Q96Q40 (CDK15_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-dependent kinase 15 EC=2.7.11.22 Alternative name(s): Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein Cell division protein kinase 15 Serine/threonine-protein kinase ALS2CR7 Serine/threonine-protein kinase PFTAIRE-2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 435 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin By similarity. |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium By similarity. |
| Sequence similarities | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily. Contains 1 protein kinase domain. |
| Sequence caution | The sequence BAD18656.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | ATP-binding Magnesium Metal-binding Nucleotide-binding |
| Molecular function | Kinase Serine/threonine-protein kinase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Inferred from electronic annotation. Source: GOC |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW cyclin-dependent protein serine/threonine kinase activityInferred from electronic annotation. Source: EC metal ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| HSP90AB1 | P08238 | 2 | EBI-1051975,EBI-352572 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96Q40-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96Q40-2) The sequence of this isoform differs from the canonical sequence as follows: 182-202: Missing. 337-422: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96Q40-3) The sequence of this isoform differs from the canonical sequence as follows: 401-435: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q96Q40-4) The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 435 | 435 | Cyclin-dependent kinase 15 | PRO_0000085619 | |||||
Regions | |||||||||
| Domain | 103 – 387 | 285 | Protein kinase | ||||||
| Nucleotide binding | 109 – 117 | 9 | ATP By similarity | ||||||
Sites | |||||||||
| Active site | 224 | 1 | Proton acceptor By similarity | ||||||
| Binding site | 132 | 1 | ATP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 4. | VSP_038765 | |||||
| Alternative sequence | 182 – 202 | 21 | Missing in isoform 2. | VSP_023743 | |||||
| Alternative sequence | 337 – 422 | 86 | EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2. | VSP_023744 | |||||
| Alternative sequence | 401 – 435 | 35 | Missing in isoform 3. | VSP_023745 | |||||
| Natural variant | 64 | 1 | R → G. Ref.7 Corresponds to variant rs34776344 [ dbSNP | Ensembl ]. | VAR_042016 | |||||
| Natural variant | 93 | 1 | K → E in a renal clear cell carcinoma sample; somatic mutation. Ref.7 | VAR_042017 | |||||
| Natural variant | 127 | 1 | Q → R. Ref.7 Corresponds to variant rs56135556 [ dbSNP | Ensembl ]. | VAR_042018 | |||||
| Natural variant | 255 | 1 | T → I. Ref.7 Corresponds to variant rs34851370 [ dbSNP | Ensembl ]. | VAR_042019 | |||||
| Natural variant | 276 | 1 | E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. Ref.7 | VAR_042020 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB053308 mRNA. Translation: BAB69017.1. AK131512 mRNA. Translation: BAD18656.1. Different initiation. AK292434 mRNA. Translation: BAF85123.1. AC007242 Genomic DNA. Translation: AAX93182.1. AC007358 Genomic DNA. Translation: AAX88914.1. CH471063 Genomic DNA. Translation: EAW70295.1. CH471063 Genomic DNA. Translation: EAW70297.1. BC038807 mRNA. Translation: AAH38807.1. |
| IPI | IPI00044678. IPI00442058. IPI00829793. IPI00955397. |
| RefSeq | NP_001248365.1. NM_001261436.1. NP_631897.1. NM_139158.2. |
| UniGene | Hs.348711. |
3D structure databases | |
| ProteinModelPortal | Q96Q40. |
| SMR | Q96Q40. Positions 60-425. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96Q40. 2 interactions. |
PTM databases | |
| PhosphoSite | Q96Q40. |
Polymorphism databases | |
| DMDM | 290457634. |
Proteomic databases | |
| PaxDb | Q96Q40. |
| PRIDE | Q96Q40. |
Protocols and materials databases | |
| DNASU | 65061. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000260967; ENSP00000260967; ENSG00000138395. ENST00000374598; ENSP00000363726; ENSG00000138395. ENST00000410091; ENSP00000386901; ENSG00000138395. ENST00000434439; ENSP00000412775; ENSG00000138395. |
| GeneID | 65061. |
| KEGG | hsa:65061. |
| UCSC | uc002uys.2. human. uc010fto.1. human. |
Organism-specific databases | |
| CTD | 65061. |
| GeneCards | GC02P202656. |
| HGNC | HGNC:14434. CDK15. |
| HPA | HPA015786. |
| neXtProt | NX_Q96Q40. |
| PharmGKB | PA165696414. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0515. |
| HOVERGEN | HBG014652. |
| InParanoid | Q96Q40. |
| KO | K15594. |
| OMA | LPSQLYQ. |
Enzyme and pathway databases | |
| BRENDA | 2.7.11.22. 2681. |
Gene expression databases | |
| ArrayExpress | Q96Q40. |
| Bgee | Q96Q40. |
| CleanEx | HS_PFTK2. |
| Genevestigator | Q96Q40. |
Family and domain databases | |
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] |
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] |
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] |
| SUPFAM | SSF56112. Kinase_like. 1 hit. |
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q96Q40. |
| ChEMBL | CHEMBL5856. |
| DrugBank | DB00171. Adenosine triphosphate. |
| GenomeRNAi | 65061. |
| NextBio | 67244. |
Entry information
| Entry name | CDK15_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96Q40 Secondary accession number(s): A8K8R9 Q8IUP1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
