Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96Q40

- CDK15_HUMAN

UniProt

Q96Q40 - CDK15_HUMAN

Protein

Cyclin-dependent kinase 15

Gene

CDK15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (02 Mar 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.By similarity

    Catalytic activityi

    ATP + a protein = ADP + a phosphoprotein.

    Cofactori

    Magnesium.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei132 – 1321ATPPROSITE-ProRule annotation
    Active sitei224 – 2241Proton acceptorPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi109 – 1179ATPPROSITE-ProRule annotation

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
    3. metal ion binding Source: UniProtKB-KW
    4. protein binding Source: IntAct

    Keywords - Molecular functioni

    Kinase, Serine/threonine-protein kinase, Transferase

    Keywords - Ligandi

    ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

    Enzyme and pathway databases

    BRENDAi2.7.11.22. 2681.
    SignaLinkiQ96Q40.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-dependent kinase 15 (EC:2.7.11.22)
    Alternative name(s):
    Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
    Cell division protein kinase 15
    Serine/threonine-protein kinase ALS2CR7
    Serine/threonine-protein kinase PFTAIRE-2
    Gene namesi
    Name:CDK15
    Synonyms:ALS2CR7, PFTK2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:14434. CDK15.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165696414.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 435435Cyclin-dependent kinase 15PRO_0000085619Add
    BLAST

    Proteomic databases

    PaxDbiQ96Q40.
    PRIDEiQ96Q40.

    PTM databases

    PhosphoSiteiQ96Q40.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96Q40.
    BgeeiQ96Q40.
    CleanExiHS_PFTK2.
    GenevestigatoriQ96Q40.

    Organism-specific databases

    HPAiHPA015786.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CDC37Q165432EBI-1051975,EBI-295634
    FKBP5Q134512EBI-1051975,EBI-306914
    HSP90AB1P082382EBI-1051975,EBI-352572

    Protein-protein interaction databases

    BioGridi122381. 13 interactions.
    IntActiQ96Q40. 10 interactions.
    MINTiMINT-7970594.
    STRINGi9606.ENSP00000260967.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96Q40.
    SMRiQ96Q40. Positions 34-425.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini103 – 387285Protein kinasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 protein kinase domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0515.
    HOVERGENiHBG014652.
    InParanoidiQ96Q40.
    KOiK15594.
    OMAiLPSQLYQ.
    PhylomeDBiQ96Q40.
    TreeFamiTF106508.

    Family and domain databases

    InterProiIPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view]
    PfamiPF00069. Pkinase. 1 hit.
    [Graphical view]
    SMARTiSM00220. S_TKc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56112. SSF56112. 1 hit.
    PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96Q40-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC    50
    SMTSFHPRGL QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA 100
    SSYLNLEKLG EGSYATVYKG ISRINGQLVA LKVISMNAEE GVPFTAIREA 150
    SLLKGLKHAN IVLLHDIIHT KETLTFVFEY MHTDLAQYMS QHPGGLHPHN 200
    VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL ADFGLARAKS 250
    IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF 300
    PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV 350
    WNRLGRVPEA EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE 400
    ESLFTVSGVR LKPEMCDLLA SYQKGHHPAQ FSKCW 435
    Length:435
    Mass (Da):49,023
    Last modified:March 2, 2010 - v2
    Checksum:iB415BBBE322EAB33
    GO
    Isoform 2 (identifier: Q96Q40-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         182-202: Missing.
         337-422: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF

    Note: No experimental confirmation available.

    Show »
    Length:358
    Mass (Da):40,122
    Checksum:iD38225492BE5B30B
    GO
    Isoform 3 (identifier: Q96Q40-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         401-435: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:400
    Mass (Da):45,046
    Checksum:iAE9AD984E40A3BF6
    GO
    Isoform 4 (identifier: Q96Q40-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: Missing.

    Show »
    Length:384
    Mass (Da):43,574
    Checksum:i6CAAD08E6E0E43EB
    GO
    Isoform 5 (identifier: Q96Q40-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         400-405: Missing.

    Note: Gene prediction based on EST data. May be due to competing acceptor splice site.

    Show »
    Length:429
    Mass (Da):48,316
    Checksum:i37ABAD0BA1B43881
    GO

    Sequence cautioni

    The sequence BAD18656.1 differs from that shown. Reason: Erroneous initiation.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti64 – 641R → G.1 Publication
    Corresponds to variant rs34776344 [ dbSNP | Ensembl ].
    VAR_042016
    Natural varianti93 – 931K → E in a renal clear cell carcinoma sample; somatic mutation. 1 Publication
    VAR_042017
    Natural varianti127 – 1271Q → R.1 Publication
    Corresponds to variant rs56135556 [ dbSNP | Ensembl ].
    VAR_042018
    Natural varianti255 – 2551T → I.1 Publication
    Corresponds to variant rs34851370 [ dbSNP | Ensembl ].
    VAR_042019
    Natural varianti276 – 2761E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. 1 Publication
    VAR_042020

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151Missing in isoform 4. 2 PublicationsVSP_038765Add
    BLAST
    Alternative sequencei182 – 20221Missing in isoform 2. 1 PublicationVSP_023743Add
    BLAST
    Alternative sequencei337 – 42286EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2. 1 PublicationVSP_023744Add
    BLAST
    Alternative sequencei400 – 4056Missing in isoform 5. CuratedVSP_047226
    Alternative sequencei401 – 43535Missing in isoform 3. 1 PublicationVSP_023745Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053308 mRNA. Translation: BAB69017.1.
    AK131512 mRNA. Translation: BAD18656.1. Different initiation.
    AK292434 mRNA. Translation: BAF85123.1.
    AC007242 Genomic DNA. Translation: AAX93182.1.
    AC007358 Genomic DNA. Translation: AAX88914.1.
    CH471063 Genomic DNA. Translation: EAW70295.1.
    CH471063 Genomic DNA. Translation: EAW70297.1.
    BC038807 mRNA. Translation: AAH38807.1.
    CCDSiCCDS2350.1. [Q96Q40-4]
    CCDS58746.1. [Q96Q40-3]
    CCDS58747.1. [Q96Q40-5]
    RefSeqiNP_001248364.1. NM_001261435.1. [Q96Q40-5]
    NP_001248365.1. NM_001261436.1. [Q96Q40-3]
    NP_631897.1. NM_139158.2. [Q96Q40-4]
    XP_005246838.1. XM_005246781.2. [Q96Q40-1]
    XP_005246839.1. XM_005246782.2. [Q96Q40-4]
    XP_005246840.1. XM_005246783.1.
    XP_006712759.1. XM_006712696.1. [Q96Q40-1]
    UniGeneiHs.348711.

    Genome annotation databases

    EnsembliENST00000260967; ENSP00000260967; ENSG00000138395. [Q96Q40-4]
    ENST00000410091; ENSP00000386901; ENSG00000138395. [Q96Q40-4]
    ENST00000434439; ENSP00000412775; ENSG00000138395. [Q96Q40-3]
    ENST00000450471; ENSP00000406472; ENSG00000138395. [Q96Q40-5]
    GeneIDi65061.
    KEGGihsa:65061.
    UCSCiuc002uys.3. human. [Q96Q40-1]
    uc010fto.2. human. [Q96Q40-2]

    Polymorphism databases

    DMDMi290457634.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB053308 mRNA. Translation: BAB69017.1 .
    AK131512 mRNA. Translation: BAD18656.1 . Different initiation.
    AK292434 mRNA. Translation: BAF85123.1 .
    AC007242 Genomic DNA. Translation: AAX93182.1 .
    AC007358 Genomic DNA. Translation: AAX88914.1 .
    CH471063 Genomic DNA. Translation: EAW70295.1 .
    CH471063 Genomic DNA. Translation: EAW70297.1 .
    BC038807 mRNA. Translation: AAH38807.1 .
    CCDSi CCDS2350.1. [Q96Q40-4 ]
    CCDS58746.1. [Q96Q40-3 ]
    CCDS58747.1. [Q96Q40-5 ]
    RefSeqi NP_001248364.1. NM_001261435.1. [Q96Q40-5 ]
    NP_001248365.1. NM_001261436.1. [Q96Q40-3 ]
    NP_631897.1. NM_139158.2. [Q96Q40-4 ]
    XP_005246838.1. XM_005246781.2. [Q96Q40-1 ]
    XP_005246839.1. XM_005246782.2. [Q96Q40-4 ]
    XP_005246840.1. XM_005246783.1.
    XP_006712759.1. XM_006712696.1. [Q96Q40-1 ]
    UniGenei Hs.348711.

    3D structure databases

    ProteinModelPortali Q96Q40.
    SMRi Q96Q40. Positions 34-425.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122381. 13 interactions.
    IntActi Q96Q40. 10 interactions.
    MINTi MINT-7970594.
    STRINGi 9606.ENSP00000260967.

    Chemistry

    BindingDBi Q96Q40.
    ChEMBLi CHEMBL5856.
    DrugBanki DB00171. Adenosine triphosphate.
    GuidetoPHARMACOLOGYi 1968.

    PTM databases

    PhosphoSitei Q96Q40.

    Polymorphism databases

    DMDMi 290457634.

    Proteomic databases

    PaxDbi Q96Q40.
    PRIDEi Q96Q40.

    Protocols and materials databases

    DNASUi 65061.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000260967 ; ENSP00000260967 ; ENSG00000138395 . [Q96Q40-4 ]
    ENST00000410091 ; ENSP00000386901 ; ENSG00000138395 . [Q96Q40-4 ]
    ENST00000434439 ; ENSP00000412775 ; ENSG00000138395 . [Q96Q40-3 ]
    ENST00000450471 ; ENSP00000406472 ; ENSG00000138395 . [Q96Q40-5 ]
    GeneIDi 65061.
    KEGGi hsa:65061.
    UCSCi uc002uys.3. human. [Q96Q40-1 ]
    uc010fto.2. human. [Q96Q40-2 ]

    Organism-specific databases

    CTDi 65061.
    GeneCardsi GC02P202656.
    HGNCi HGNC:14434. CDK15.
    HPAi HPA015786.
    neXtProti NX_Q96Q40.
    PharmGKBi PA165696414.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0515.
    HOVERGENi HBG014652.
    InParanoidi Q96Q40.
    KOi K15594.
    OMAi LPSQLYQ.
    PhylomeDBi Q96Q40.
    TreeFami TF106508.

    Enzyme and pathway databases

    BRENDAi 2.7.11.22. 2681.
    SignaLinki Q96Q40.

    Miscellaneous databases

    GenomeRNAii 65061.
    NextBioi 67244.
    PROi Q96Q40.

    Gene expression databases

    ArrayExpressi Q96Q40.
    Bgeei Q96Q40.
    CleanExi HS_PFTK2.
    Genevestigatori Q96Q40.

    Family and domain databases

    InterProi IPR011009. Kinase-like_dom.
    IPR000719. Prot_kinase_dom.
    IPR017441. Protein_kinase_ATP_BS.
    IPR002290. Ser/Thr_dual-sp_kinase_dom.
    IPR008271. Ser/Thr_kinase_AS.
    [Graphical view ]
    Pfami PF00069. Pkinase. 1 hit.
    [Graphical view ]
    SMARTi SM00220. S_TKc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56112. SSF56112. 1 hit.
    PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
    PS50011. PROTEIN_KINASE_DOM. 1 hit.
    PS00108. PROTEIN_KINASE_ST. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Testis.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Glial tumor and Testis.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    6. Cited for: NOMENCLATURE.
    7. "Patterns of somatic mutation in human cancer genomes."
      Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
      , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
      Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-64; GLU-93; ARG-127; ILE-255 AND ASP-276.

    Entry informationi

    Entry nameiCDK15_HUMAN
    AccessioniPrimary (citable) accession number: Q96Q40
    Secondary accession number(s): A8K8R9
    , B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: March 2, 2010
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. Human and mouse protein kinases
      Human and mouse protein kinases: classification and index
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3