Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96Q40

- CDK15_HUMAN

UniProt

Q96Q40 - CDK15_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-dependent kinase 15

Gene

CDK15

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin.By similarity

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei132 – 1321ATPPROSITE-ProRule annotation
Active sitei224 – 2241Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi109 – 1179ATPPROSITE-ProRule annotation

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. cyclin-dependent protein serine/threonine kinase activity Source: UniProtKB-EC
  3. metal ion binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 2681.
SignaLinkiQ96Q40.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 15 (EC:2.7.11.22)
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
Cell division protein kinase 15
Serine/threonine-protein kinase ALS2CR7
Serine/threonine-protein kinase PFTAIRE-2
Gene namesi
Name:CDK15
Synonyms:ALS2CR7, PFTK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:14434. CDK15.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165696414.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 435435Cyclin-dependent kinase 15PRO_0000085619Add
BLAST

Proteomic databases

PaxDbiQ96Q40.
PRIDEiQ96Q40.

PTM databases

PhosphoSiteiQ96Q40.

Expressioni

Gene expression databases

BgeeiQ96Q40.
CleanExiHS_PFTK2.
ExpressionAtlasiQ96Q40. baseline and differential.
GenevestigatoriQ96Q40.

Organism-specific databases

HPAiHPA015786.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CDC37Q165432EBI-1051975,EBI-295634
FKBP5Q134512EBI-1051975,EBI-306914
HSP90AB1P082382EBI-1051975,EBI-352572

Protein-protein interaction databases

BioGridi122381. 25 interactions.
IntActiQ96Q40. 10 interactions.
MINTiMINT-7970594.
STRINGi9606.ENSP00000260967.

Structurei

3D structure databases

ProteinModelPortaliQ96Q40.
SMRiQ96Q40. Positions 34-425.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini103 – 387285Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0515.
GeneTreeiENSGT00600000083998.
HOVERGENiHBG014652.
InParanoidiQ96Q40.
KOiK15594.
OMAiLPSQLYQ.
PhylomeDBiQ96Q40.
TreeFamiTF106508.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96Q40-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC
60 70 80 90 100
SMTSFHPRGL QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA
110 120 130 140 150
SSYLNLEKLG EGSYATVYKG ISRINGQLVA LKVISMNAEE GVPFTAIREA
160 170 180 190 200
SLLKGLKHAN IVLLHDIIHT KETLTFVFEY MHTDLAQYMS QHPGGLHPHN
210 220 230 240 250
VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL ADFGLARAKS
260 270 280 290 300
IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF
310 320 330 340 350
PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV
360 370 380 390 400
WNRLGRVPEA EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE
410 420 430
ESLFTVSGVR LKPEMCDLLA SYQKGHHPAQ FSKCW
Length:435
Mass (Da):49,023
Last modified:March 2, 2010 - v2
Checksum:iB415BBBE322EAB33
GO
Isoform 2 (identifier: Q96Q40-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-202: Missing.
     337-422: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF

Note: No experimental confirmation available.

Show »
Length:358
Mass (Da):40,122
Checksum:iD38225492BE5B30B
GO
Isoform 3 (identifier: Q96Q40-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-435: Missing.

Note: No experimental confirmation available.

Show »
Length:400
Mass (Da):45,046
Checksum:iAE9AD984E40A3BF6
GO
Isoform 4 (identifier: Q96Q40-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.

Show »
Length:384
Mass (Da):43,574
Checksum:i6CAAD08E6E0E43EB
GO
Isoform 5 (identifier: Q96Q40-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-405: Missing.

Note: Gene prediction based on EST data. May be due to competing acceptor splice site.

Show »
Length:429
Mass (Da):48,316
Checksum:i37ABAD0BA1B43881
GO

Sequence cautioni

The sequence BAD18656.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti64 – 641R → G.1 Publication
Corresponds to variant rs34776344 [ dbSNP | Ensembl ].
VAR_042016
Natural varianti93 – 931K → E in a renal clear cell carcinoma sample; somatic mutation. 1 Publication
VAR_042017
Natural varianti127 – 1271Q → R.1 Publication
Corresponds to variant rs56135556 [ dbSNP | Ensembl ].
VAR_042018
Natural varianti255 – 2551T → I.1 Publication
Corresponds to variant rs34851370 [ dbSNP | Ensembl ].
VAR_042019
Natural varianti276 – 2761E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. 1 Publication
VAR_042020

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151Missing in isoform 4. 2 PublicationsVSP_038765Add
BLAST
Alternative sequencei182 – 20221Missing in isoform 2. 1 PublicationVSP_023743Add
BLAST
Alternative sequencei337 – 42286EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2. 1 PublicationVSP_023744Add
BLAST
Alternative sequencei400 – 4056Missing in isoform 5. CuratedVSP_047226
Alternative sequencei401 – 43535Missing in isoform 3. 1 PublicationVSP_023745Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053308 mRNA. Translation: BAB69017.1.
AK131512 mRNA. Translation: BAD18656.1. Different initiation.
AK292434 mRNA. Translation: BAF85123.1.
AC007242 Genomic DNA. Translation: AAX93182.1.
AC007358 Genomic DNA. Translation: AAX88914.1.
CH471063 Genomic DNA. Translation: EAW70295.1.
CH471063 Genomic DNA. Translation: EAW70297.1.
BC038807 mRNA. Translation: AAH38807.1.
CCDSiCCDS2350.1. [Q96Q40-4]
CCDS58746.1. [Q96Q40-3]
CCDS58747.1. [Q96Q40-5]
RefSeqiNP_001248364.1. NM_001261435.1. [Q96Q40-5]
NP_001248365.1. NM_001261436.1. [Q96Q40-3]
NP_631897.1. NM_139158.2. [Q96Q40-4]
XP_005246838.1. XM_005246781.2. [Q96Q40-1]
XP_005246839.1. XM_005246782.2. [Q96Q40-4]
XP_005246840.1. XM_005246783.1.
XP_006712759.1. XM_006712696.1. [Q96Q40-1]
UniGeneiHs.348711.

Genome annotation databases

EnsembliENST00000260967; ENSP00000260967; ENSG00000138395. [Q96Q40-4]
ENST00000410091; ENSP00000386901; ENSG00000138395. [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395. [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395. [Q96Q40-5]
GeneIDi65061.
KEGGihsa:65061.
UCSCiuc002uys.3. human. [Q96Q40-1]
uc010fto.2. human. [Q96Q40-2]

Polymorphism databases

DMDMi290457634.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053308 mRNA. Translation: BAB69017.1 .
AK131512 mRNA. Translation: BAD18656.1 . Different initiation.
AK292434 mRNA. Translation: BAF85123.1 .
AC007242 Genomic DNA. Translation: AAX93182.1 .
AC007358 Genomic DNA. Translation: AAX88914.1 .
CH471063 Genomic DNA. Translation: EAW70295.1 .
CH471063 Genomic DNA. Translation: EAW70297.1 .
BC038807 mRNA. Translation: AAH38807.1 .
CCDSi CCDS2350.1. [Q96Q40-4 ]
CCDS58746.1. [Q96Q40-3 ]
CCDS58747.1. [Q96Q40-5 ]
RefSeqi NP_001248364.1. NM_001261435.1. [Q96Q40-5 ]
NP_001248365.1. NM_001261436.1. [Q96Q40-3 ]
NP_631897.1. NM_139158.2. [Q96Q40-4 ]
XP_005246838.1. XM_005246781.2. [Q96Q40-1 ]
XP_005246839.1. XM_005246782.2. [Q96Q40-4 ]
XP_005246840.1. XM_005246783.1.
XP_006712759.1. XM_006712696.1. [Q96Q40-1 ]
UniGenei Hs.348711.

3D structure databases

ProteinModelPortali Q96Q40.
SMRi Q96Q40. Positions 34-425.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122381. 25 interactions.
IntActi Q96Q40. 10 interactions.
MINTi MINT-7970594.
STRINGi 9606.ENSP00000260967.

Chemistry

BindingDBi Q96Q40.
ChEMBLi CHEMBL5856.
DrugBanki DB00171. Adenosine triphosphate.
GuidetoPHARMACOLOGYi 1968.

PTM databases

PhosphoSitei Q96Q40.

Polymorphism databases

DMDMi 290457634.

Proteomic databases

PaxDbi Q96Q40.
PRIDEi Q96Q40.

Protocols and materials databases

DNASUi 65061.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000260967 ; ENSP00000260967 ; ENSG00000138395 . [Q96Q40-4 ]
ENST00000410091 ; ENSP00000386901 ; ENSG00000138395 . [Q96Q40-4 ]
ENST00000434439 ; ENSP00000412775 ; ENSG00000138395 . [Q96Q40-3 ]
ENST00000450471 ; ENSP00000406472 ; ENSG00000138395 . [Q96Q40-5 ]
GeneIDi 65061.
KEGGi hsa:65061.
UCSCi uc002uys.3. human. [Q96Q40-1 ]
uc010fto.2. human. [Q96Q40-2 ]

Organism-specific databases

CTDi 65061.
GeneCardsi GC02P202656.
HGNCi HGNC:14434. CDK15.
HPAi HPA015786.
neXtProti NX_Q96Q40.
PharmGKBi PA165696414.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
GeneTreei ENSGT00600000083998.
HOVERGENi HBG014652.
InParanoidi Q96Q40.
KOi K15594.
OMAi LPSQLYQ.
PhylomeDBi Q96Q40.
TreeFami TF106508.

Enzyme and pathway databases

BRENDAi 2.7.11.22. 2681.
SignaLinki Q96Q40.

Miscellaneous databases

GenomeRNAii 65061.
NextBioi 67244.
PROi Q96Q40.

Gene expression databases

Bgeei Q96Q40.
CleanExi HS_PFTK2.
ExpressionAtlasi Q96Q40. baseline and differential.
Genevestigatori Q96Q40.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF00069. Pkinase. 1 hit.
[Graphical view ]
SMARTi SM00220. S_TKc. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 1 hit.
PROSITEi PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Glial tumor and Testis.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  6. Cited for: NOMENCLATURE.
  7. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-64; GLU-93; ARG-127; ILE-255 AND ASP-276.

Entry informationi

Entry nameiCDK15_HUMAN
AccessioniPrimary (citable) accession number: Q96Q40
Secondary accession number(s): A8K8R9
, B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 2, 2010
Last modified: November 26, 2014
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3