Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-dependent kinase 15

Gene

CDK15

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase that acts like an antiapoptotic protein that counters TRAIL/TNFSF10-induced apoptosis by inducing phosphorylation of BIRC5 at 'Thr-34'.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Cofactori

Mg2+By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei132ATPPROSITE-ProRule annotation1
Active sitei224Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi109 – 117ATPPROSITE-ProRule annotation9

GO - Molecular functioni

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.7.11.22. 2681.
SignaLinkiQ96Q40.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-dependent kinase 15 (EC:2.7.11.221 Publication)
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
Cell division protein kinase 15
Serine/threonine-protein kinase ALS2CR7
Serine/threonine-protein kinase PFTAIRE-2
Gene namesi
Name:CDK15
Synonyms:ALS2CR7, PFTK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000138395.14.
HGNCiHGNC:14434. CDK15.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi65061.
OpenTargetsiENSG00000138395.
PharmGKBiPA165696414.

Chemistry databases

ChEMBLiCHEMBL5856.
DrugBankiDB00171. Adenosine triphosphate.
GuidetoPHARMACOLOGYi1968.

Polymorphism and mutation databases

BioMutaiCDK15.
DMDMi290457634.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000856191 – 435Cyclin-dependent kinase 15Add BLAST435

Proteomic databases

MaxQBiQ96Q40.
PaxDbiQ96Q40.
PeptideAtlasiQ96Q40.
PRIDEiQ96Q40.

PTM databases

iPTMnetiQ96Q40.
PhosphoSitePlusiQ96Q40.

Expressioni

Gene expression databases

BgeeiENSG00000138395.
CleanExiHS_PFTK2.
ExpressionAtlasiQ96Q40. baseline and differential.
GenevisibleiQ96Q40. HS.

Organism-specific databases

HPAiHPA015786.

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi122381. 117 interactors.
IntActiQ96Q40. 11 interactors.
MINTiMINT-7970594.
STRINGi9606.ENSP00000260967.

Chemistry databases

BindingDBiQ96Q40.

Structurei

3D structure databases

ProteinModelPortaliQ96Q40.
SMRiQ96Q40.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 387Protein kinasePROSITE-ProRule annotationAdd BLAST285

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG0594. Eukaryota.
ENOG410XPP3. LUCA.
GeneTreeiENSGT00890000139329.
HOVERGENiHBG014652.
InParanoidiQ96Q40.
KOiK15594.
OMAiLKPEMCD.
OrthoDBiEOG091G0CH0.
PhylomeDBiQ96Q40.
TreeFamiTF106508.

Family and domain databases

InterProiView protein in InterPro
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
PfamiView protein in Pfam
PF00069. Pkinase. 1 hit.
SMARTiView protein in SMART
SM00220. S_TKc. 1 hit.
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiView protein in PROSITE
PS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96Q40-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC
60 70 80 90 100
SMTSFHPRGL QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA
110 120 130 140 150
SSYLNLEKLG EGSYATVYKG ISRINGQLVA LKVISMNAEE GVPFTAIREA
160 170 180 190 200
SLLKGLKHAN IVLLHDIIHT KETLTFVFEY MHTDLAQYMS QHPGGLHPHN
210 220 230 240 250
VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL ADFGLARAKS
260 270 280 290 300
IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF
310 320 330 340 350
PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV
360 370 380 390 400
WNRLGRVPEA EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE
410 420 430
ESLFTVSGVR LKPEMCDLLA SYQKGHHPAQ FSKCW
Length:435
Mass (Da):49,023
Last modified:March 2, 2010 - v2
Checksum:iB415BBBE322EAB33
GO
Isoform 2 (identifier: Q96Q40-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     182-202: Missing.
     337-422: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF

Note: No experimental confirmation available.
Show »
Length:358
Mass (Da):40,122
Checksum:iD38225492BE5B30B
GO
Isoform 3 (identifier: Q96Q40-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     401-435: Missing.

Note: No experimental confirmation available.
Show »
Length:400
Mass (Da):45,046
Checksum:iAE9AD984E40A3BF6
GO
Isoform 4 (identifier: Q96Q40-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.

Show »
Length:384
Mass (Da):43,574
Checksum:i6CAAD08E6E0E43EB
GO
Isoform 5 (identifier: Q96Q40-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     400-405: Missing.

Note: Gene prediction based on EST data. May be due to competing acceptor splice site.
Show »
Length:429
Mass (Da):48,316
Checksum:i37ABAD0BA1B43881
GO

Sequence cautioni

The sequence BAD18656 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04201664R → G1 PublicationCorresponds to variant dbSNP:rs34776344Ensembl.1
Natural variantiVAR_04201793K → E in a renal clear cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_042018127Q → R1 PublicationCorresponds to variant dbSNP:rs56135556Ensembl.1
Natural variantiVAR_042019255T → I1 PublicationCorresponds to variant dbSNP:rs34851370Ensembl.1
Natural variantiVAR_042020276E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0387651 – 51Missing in isoform 4. 2 PublicationsAdd BLAST51
Alternative sequenceiVSP_023743182 – 202Missing in isoform 2. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_023744337 – 422EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2. 1 PublicationAdd BLAST86
Alternative sequenceiVSP_047226400 – 405Missing in isoform 5. Curated6
Alternative sequenceiVSP_023745401 – 435Missing in isoform 3. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053308 mRNA. Translation: BAB69017.1.
AK131512 mRNA. Translation: BAD18656.1. Different initiation.
AK292434 mRNA. Translation: BAF85123.1.
AC007242 Genomic DNA. Translation: AAX93182.1.
AC007358 Genomic DNA. Translation: AAX88914.1.
CH471063 Genomic DNA. Translation: EAW70295.1.
CH471063 Genomic DNA. Translation: EAW70297.1.
BC038807 mRNA. Translation: AAH38807.1.
CCDSiCCDS2350.1. [Q96Q40-4]
CCDS58746.1. [Q96Q40-3]
CCDS58747.1. [Q96Q40-5]
RefSeqiNP_001248364.1. NM_001261435.1. [Q96Q40-5]
NP_001248365.1. NM_001261436.1. [Q96Q40-3]
NP_631897.1. NM_139158.2. [Q96Q40-4]
XP_005246838.1. XM_005246781.3. [Q96Q40-1]
XP_005246839.1. XM_005246782.4. [Q96Q40-4]
UniGeneiHs.348711.

Genome annotation databases

EnsembliENST00000260967; ENSP00000260967; ENSG00000138395. [Q96Q40-4]
ENST00000410091; ENSP00000386901; ENSG00000138395. [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395. [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395. [Q96Q40-5]
GeneIDi65061.
KEGGihsa:65061.
UCSCiuc002uys.4. human. [Q96Q40-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCDK15_HUMAN
AccessioniPrimary (citable) accession number: Q96Q40
Secondary accession number(s): A8K8R9
, B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 2, 2010
Last modified: September 27, 2017
This is version 147 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  6. SIMILARITY comments
    Index of protein domains and families