Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96Q40 (CDK15_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cyclin-dependent kinase 15

EC=2.7.11.22
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein
Cell division protein kinase 15
Serine/threonine-protein kinase ALS2CR7
Serine/threonine-protein kinase PFTAIRE-2
Gene names
Name:CDK15
Synonyms:ALS2CR7, PFTK2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length435 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Serine/threonine-protein kinase involved in the control of the eukaryotic cell cycle, whose activity is controlled by an associated cyclin By similarity.

Catalytic activity

ATP + a protein = ADP + a phosphoprotein.

Cofactor

Magnesium By similarity.

Sequence similarities

Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.

Contains 1 protein kinase domain.

Sequence caution

The sequence BAD18656.1 differs from that shown. Reason: Erroneous initiation.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

HSP90AB1P082382EBI-1051975,EBI-352572

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96Q40-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96Q40-2)

The sequence of this isoform differs from the canonical sequence as follows:
     182-202: Missing.
     337-422: EWFPLPTPRS...PEMCDLLASY → GGSKKQHGWHTDIGQHRTAAMQPCSRNVSF
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96Q40-3)

The sequence of this isoform differs from the canonical sequence as follows:
     401-435: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96Q40-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
Isoform 5 (identifier: Q96Q40-5)

The sequence of this isoform differs from the canonical sequence as follows:
     400-405: Missing.
Note: Gene prediction based on EST data. May be due to competing acceptor splice site.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 435435Cyclin-dependent kinase 15
PRO_0000085619

Regions

Domain103 – 387285Protein kinase
Nucleotide binding109 – 1179ATP By similarity

Sites

Active site2241Proton acceptor By similarity
Binding site1321ATP By similarity

Natural variations

Alternative sequence1 – 5151Missing in isoform 4.
VSP_038765
Alternative sequence182 – 20221Missing in isoform 2.
VSP_023743
Alternative sequence337 – 42286EWFPL…LLASY → GGSKKQHGWHTDIGQHRTAA MQPCSRNVSF in isoform 2.
VSP_023744
Alternative sequence400 – 4056Missing in isoform 5.
VSP_047226
Alternative sequence401 – 43535Missing in isoform 3.
VSP_023745
Natural variant641R → G. Ref.7
Corresponds to variant rs34776344 [ dbSNP | Ensembl ].
VAR_042016
Natural variant931K → E in a renal clear cell carcinoma sample; somatic mutation. Ref.7
VAR_042017
Natural variant1271Q → R. Ref.7
Corresponds to variant rs56135556 [ dbSNP | Ensembl ].
VAR_042018
Natural variant2551T → I. Ref.7
Corresponds to variant rs34851370 [ dbSNP | Ensembl ].
VAR_042019
Natural variant2761E → D in a breast infiltrating ductal carcinoma sample; somatic mutation. Ref.7
VAR_042020

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 2, 2010. Version 2.
Checksum: B415BBBE322EAB33

FASTA43549,023
        10         20         30         40         50         60 
MGQELCAKTV QPGCSCYHCS EGGEAHSCRR SQPETTEAAF KLTDLKEASC SMTSFHPRGL 

        70         80         90        100        110        120 
QAARAQKFKS KRPRSNSDCF QEEDLRQGFQ WRKSLPFGAA SSYLNLEKLG EGSYATVYKG 

       130        140        150        160        170        180 
ISRINGQLVA LKVISMNAEE GVPFTAIREA SLLKGLKHAN IVLLHDIIHT KETLTFVFEY 

       190        200        210        220        230        240 
MHTDLAQYMS QHPGGLHPHN VRLFMFQLLR GLAYIHHQHV LHRDLKPQNL LISHLGELKL 

       250        260        270        280        290        300 
ADFGLARAKS IPSQTYSSEV VTLWYRPPDA LLGATEYSSE LDIWGAGCIF IEMFQGQPLF 

       310        320        330        340        350        360 
PGVSNILEQL EKIWEVLGVP TEDTWPGVSK LPNYNPEWFP LPTPRSLHVV WNRLGRVPEA 

       370        380        390        400        410        420 
EDLASQMLKG FPRDRVSAQE ALVHDYFSAL PSQLYQLPDE ESLFTVSGVR LKPEMCDLLA 

       430 
SYQKGHHPAQ FSKCW 

« Hide

Isoform 2 [UniParc].

Checksum: D38225492BE5B30B
Show »

FASTA35840,122
Isoform 3 [UniParc].

Checksum: AE9AD984E40A3BF6
Show »

FASTA40045,046
Isoform 4 [UniParc].

Checksum: 6CAAD08E6E0E43EB
Show »

FASTA38443,574
Isoform 5 [UniParc].

Checksum: 37ABAD0BA1B43881
Show »

FASTA42948,316

References

« Hide 'large scale' references
[1]"A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2."
Hadano S., Hand C.K., Osuga H., Yanagisawa Y., Otomo A., Devon R.S., Miyamoto N., Showguchi-Miyata J., Okada Y., Singaraja R., Figlewicz D.A., Kwiatkowski T., Hosler B.A., Sagie T., Skaug J., Nasir J., Brown R.H. Jr., Scherer S.W. expand/collapse author list , Rouleau G.A., Hayden M.R., Ikeda J.-E.
Nat. Genet. 29:166-173(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Testis.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Tissue: Glial tumor and Testis.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Brain.
[6]"The protein kinase complement of the human genome."
Manning G., Whyte D.B., Martinez R., Hunter T., Sudarsanam S.
Science 298:1912-1934(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NOMENCLATURE.
[7]"Patterns of somatic mutation in human cancer genomes."
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. expand/collapse author list , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANTS [LARGE SCALE ANALYSIS] GLY-64; GLU-93; ARG-127; ILE-255 AND ASP-276.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB053308 mRNA. Translation: BAB69017.1.
AK131512 mRNA. Translation: BAD18656.1. Different initiation.
AK292434 mRNA. Translation: BAF85123.1.
AC007242 Genomic DNA. Translation: AAX93182.1.
AC007358 Genomic DNA. Translation: AAX88914.1.
CH471063 Genomic DNA. Translation: EAW70295.1.
CH471063 Genomic DNA. Translation: EAW70297.1.
BC038807 mRNA. Translation: AAH38807.1.
RefSeqNP_001248364.1. NM_001261435.1.
NP_001248365.1. NM_001261436.1.
NP_631897.1. NM_139158.2.
XP_005246838.1. XM_005246781.2.
XP_005246839.1. XM_005246782.2.
XP_005246840.1. XM_005246783.1.
UniGeneHs.348711.

3D structure databases

ProteinModelPortalQ96Q40.
SMRQ96Q40. Positions 34-426.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122381. 13 interactions.
IntActQ96Q40. 8 interactions.
MINTMINT-7970594.
STRING9606.ENSP00000260967.

Chemistry

BindingDBQ96Q40.
ChEMBLCHEMBL5856.
DrugBankDB00171. Adenosine triphosphate.
GuidetoPHARMACOLOGY1968.

PTM databases

PhosphoSiteQ96Q40.

Polymorphism databases

DMDM290457634.

Proteomic databases

PaxDbQ96Q40.
PRIDEQ96Q40.

Protocols and materials databases

DNASU65061.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000260967; ENSP00000260967; ENSG00000138395. [Q96Q40-4]
ENST00000374598; ENSP00000363726; ENSG00000138395. [Q96Q40-1]
ENST00000410091; ENSP00000386901; ENSG00000138395. [Q96Q40-4]
ENST00000434439; ENSP00000412775; ENSG00000138395. [Q96Q40-3]
ENST00000450471; ENSP00000406472; ENSG00000138395. [Q96Q40-5]
GeneID65061.
KEGGhsa:65061.
UCSCuc002uys.3. human. [Q96Q40-1]
uc010fto.2. human. [Q96Q40-2]

Organism-specific databases

CTD65061.
GeneCardsGC02P202656.
HGNCHGNC:14434. CDK15.
HPAHPA015786.
neXtProtNX_Q96Q40.
PharmGKBPA165696414.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0515.
HOVERGENHBG014652.
InParanoidQ96Q40.
KOK15594.
OMALPSQLYQ.
PhylomeDBQ96Q40.
TreeFamTF106508.

Enzyme and pathway databases

BRENDA2.7.11.22. 2681.
SignaLinkQ96Q40.

Gene expression databases

ArrayExpressQ96Q40.
BgeeQ96Q40.
CleanExHS_PFTK2.
GenevestigatorQ96Q40.

Family and domain databases

InterProIPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR002290. Ser/Thr_dual-sp_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMSSF56112. SSF56112. 1 hit.
PROSITEPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi65061.
NextBio67244.
PROQ96Q40.

Entry information

Entry nameCDK15_HUMAN
AccessionPrimary (citable) accession number: Q96Q40
Secondary accession number(s): A8K8R9 expand/collapse secondary AC list , B8ZZX0, C9J1N8, C9K003, F8W6H8, Q4ZG86, Q53TV1, Q6ZMR9, Q8IUP1
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: March 2, 2010
Last modified: April 16, 2014
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human and mouse protein kinases

Human and mouse protein kinases: classification and index

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM