Q96PV0 (SYGP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras GTPase-activating protein SynGAP Alternative name(s): Neuronal RasGAP Synaptic Ras GTPase-activating protein 1 Short name=Synaptic Ras-GAP 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1343 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits By similarity. |
| Subunit structure | Interacts KLHL17, CAMK2A and CAMK2B By similarity. Interacts with MPDZ. Ref.4 |
| Post-translational modification | Phosphorylated by CaM-kinase II. Dephosphorylated upon NMDA receptor activation or SYNGAP1/MPDZ complex disruption. Phosphorylation by PLK2 promotes its activity By similarity. |
| Involvement in disease | Mental retardation, autosomal dominant 5 (MRD5) [MIM:612621]: A disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. MRD5 patients show global developmental delay with delayed motor development, hypotonia, moderate-to-severe mental retardation, and severe language impairment. Autism can be present in some patients. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PH domain. Contains 1 Ras-GAP domain. |
| Caution | It is uncertain whether Met-1 or Met-16 is the initiator methionine. |
| Sequence caution | The sequence BAB67831.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q96PV0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96PV0-2) The sequence of this isoform differs from the canonical sequence as follows: 1265-1343: RLMLVEEELR...NGEFRNTADH → SPSLQADAGGGGAAPGPPRHG | ||||||
| Isoform 3 (identifier: Q96PV0-3) The sequence of this isoform differs from the canonical sequence as follows: 1-98: MSRSRASIHR...PVEGRPHGEH → MGLRPPTPSP...RRCSSCCFPG | ||||||
| Isoform 4 (identifier: Q96PV0-4) The sequence of this isoform differs from the canonical sequence as follows: 1296-1343: ERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH → LLIR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1343 | 1343 | Ras GTPase-activating protein SynGAP | PRO_0000056654 | |||||
Regions | |||||||||
| Domain | 150 – 251 | 102 | PH | ||||||
| Domain | 249 – 347 | 99 | C2 | ||||||
| Domain | 443 – 635 | 193 | Ras-GAP | ||||||
| Motif | 785 – 815 | 31 | SH3-binding Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 379 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 385 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 449 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 466 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 836 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 840 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 842 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
| Modified residue | 895 | 1 | Phosphoserine; by PLK2 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 98 | 98 | MSRSR…PHGEH → MGLRPPTPSPSGGSCSGSLP PPSRCQPLRRRCSSCCFPG in isoform 3. | VSP_026376 | |||||
| Alternative sequence | 1265 – 1343 | 79 | RLMLV…NTADH → SPSLQADAGGGGAAPGPPRH G in isoform 2. | VSP_007973 | |||||
| Alternative sequence | 1296 – 1343 | 48 | ERQLP…NTADH → LLIR in isoform 4. | VSP_026377 | |||||
| Natural variant | 201 | 1 | D → E. Ref.5 | VAR_065078 | |||||
| Natural variant | 749 | 1 | R → Q. Ref.5 | VAR_065079 | |||||
| Natural variant | 790 | 1 | T → N. Ref.5 | VAR_065080 | |||||
| Natural variant | 991 | 1 | G → R. Ref.7 | VAR_065081 | |||||
| Natural variant | 1115 | 1 | I → T. Ref.5 Ref.7 | VAR_065082 | |||||
| Natural variant | 1283 | 1 | P → L. Ref.5 | VAR_065083 | |||||
| Natural variant | 1310 | 1 | T → M. Ref.5 | VAR_065084 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB067525 mRNA. Translation: BAB67831.2. Different initiation. AL021366 Genomic DNA. Translation: CAA16161.1. AL662799 Genomic DNA. Translation: CAI18276.2. AL662799 Genomic DNA. Translation: CAM25572.1. BX088650 Genomic DNA. Translation: CAM26304.1. BX088650 Genomic DNA. Translation: CAM26305.1. BX088650 Genomic DNA. Translation: CAM26306.1. AL713634 mRNA. Translation: CAD28452.1. |
| IPI | IPI00177884. IPI00337790. IPI00796859. IPI00847493. |
| RefSeq | NP_006763.2. NM_006772.2. |
| UniGene | Hs.586264. |
3D structure databases | |
| ProteinModelPortal | Q96PV0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96PV0. 6 interactions. |
| STRING | 9606.ENSP00000403636. |
PTM databases | |
| PhosphoSite | Q96PV0. |
Polymorphism databases | |
| DMDM | 150421676. |
Proteomic databases | |
| PaxDb | Q96PV0. |
| PRIDE | Q96PV0. |
Protocols and materials databases | |
| DNASU | 8831. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000293748; ENSP00000293748; ENSG00000197283. ENST00000395071; ENSP00000378509; ENSG00000227460. ENST00000414753; ENSP00000407995; ENSG00000227460. ENST00000418600; ENSP00000403636; ENSG00000197283. ENST00000428982; ENSP00000412475; ENSG00000197283. ENST00000440474; ENSP00000410023; ENSG00000197283. ENST00000455687; ENSP00000414259; ENSG00000227460. ENST00000551507; ENSP00000446753; ENSG00000227460. |
| GeneID | 8831. |
| KEGG | hsa:8831. |
| UCSC | uc010juz.3. human. uc011dri.2. human. |
Organism-specific databases | |
| CTD | 8831. |
| GeneCards | GC06P033387. |
| HGNC | HGNC:11497. SYNGAP1. |
| HPA | HPA038373. |
| MIM | 603384. gene. 612621. phenotype. |
| neXtProt | NX_Q96PV0. |
| Orphanet | 178469. Autosomal dominant nonsyndromic intellectual deficit. |
| PharmGKB | PA36279. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG245428. |
| HOVERGEN | HBG006492. |
| InParanoid | Q96PV0. |
| OMA | NPHIQRQ. |
| OrthoDB | EOG49ZXNH. |
Gene expression databases | |
| ArrayExpress | Q96PV0. |
| Bgee | Q96PV0. |
| CleanEx | HS_SYNGAP1. |
| Genevestigator | Q96PV0. |
| GermOnline | ENSG00000197283. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.506.10. 1 hit. 2.20.170.10. 1 hit. 2.30.29.30. 2 hits. |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR021887. DUF3498. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR001936. RasGAP. IPR023152. RasGAP_CS. IPR008936. Rho_GTPase_activation_prot. IPR023315. SynGAP_C2_N. [Graphical view] |
| Pfam | PF00168. C2. 1 hit. PF12004. DUF3498. 1 hit. PF00616. RasGAP. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. SM00233. PH. 1 hit. SM00323. RasGAP. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF48350. Rho_GAP. 1 hit. |
| PROSITE | PS50004. C2. False negative. PS50003. PH_DOMAIN. 1 hit. PS00509. RAS_GTPASE_ACTIV_1. 1 hit. PS50018. RAS_GTPASE_ACTIV_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 8831. |
| NextBio | 33144. |
| SOURCE | Search... |
Entry information
| Entry name | SYGP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96PV0 Secondary accession number(s): A2AB17 Q9UGE2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
