Q96PU9 (ODF3A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Outer dense fiber protein 3 Alternative name(s): Outer dense fiber of sperm tails protein 3 Sperm tail protein SHIPPO 1 Transcript induced in spermiogenesis protein 50 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 254 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Outer dense fibers are filamentous structures located on the outside of the axoneme in the midpiece and principal piece of the mammalian sperm tail. May help to maintain the passive elastic structures and elastic recoil of the sperm tail. |
| Subcellular location | Cytoplasm By similarity. Note: Expressed in the cytoplasmic lobe of spermatids By similarity. |
| Tissue specificity | |
| Miscellaneous | 'Shippo' is a Japanese word for tail. |
| Sequence similarities | Belongs to the ODF3 family. Contains 2 DUF1309 repeats. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Spermatogenesis |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| Molecular function | Developmental protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | cell differentiation Inferred from electronic annotation. Source: UniProtKB-KW multicellular organismal developmentInferred from electronic annotation. Source: UniProtKB-KW spermatogenesisInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96PU9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96PU9-2) The sequence of this isoform differs from the canonical sequence as follows: 104-138: GDYFPEKSTKYVFDSAPSHSISARTKAFRVDSTPG → ALKSAFPSWTPRDPTWSPPVLEPRGPTPRMLGSPP 139-254: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 254 | 254 | Outer dense fiber protein 3 | PRO_0000299464 | |||||
Regions | |||||||||
| Repeat | 180 – 205 | 26 | DUF1309 1 | ||||||
| Repeat | 216 – 241 | 26 | DUF1309 2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 104 – 138 | 35 | GDYFP…DSTPG → ALKSAFPSWTPRDPTWSPPV LEPRGPTPRMLGSPP in isoform 2. | VSP_027686 | |||||
| Alternative sequence | 139 – 254 | 116 | Missing in isoform 2. | VSP_027687 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a complementary DNA encoding sperm tail protein SHIPPO 1." Egydio de Carvalho C., Tanaka H., Iguchi N., Ventela S., Nojima H., Nishimune Y. Biol. Reprod. 66:785-795(2002) [PubMed: 11870087] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "The human transcript induced in spermatogenesis 50." Sasaki Y., Miyamoto T., Sengoku K., Hayashi H., Takuma N., Ishikawa M. Reprod. Med. Biol. 3:237-243(2004) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB067774 mRNA. Translation: BAB70734.1. AY713299 mRNA. Translation: AAW83203.1. AL133658 mRNA. Translation: CAH10709.1. BC126222 mRNA. Translation: AAI26223.1. BC126248 mRNA. Translation: AAI26249.1. |
| IPI | IPI00102524. IPI00743900. |
| RefSeq | NP_444510.2. NM_053280.3. |
| UniGene | Hs.350949. |
3D structure databases | |
| ProteinModelPortal | Q96PU9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96PU9. |
PTM databases | |
| PhosphoSite | Q96PU9. |
Polymorphism databases | |
| DMDM | 74717117. |
Proteomic databases | |
| PRIDE | Q96PU9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000325113; ENSP00000325868; ENSG00000177947. |
| GeneID | 113746. |
| KEGG | hsa:113746. |
| UCSC | uc001lob.1. human. uc001loc.2. human. |
Organism-specific databases | |
| CTD | 113746. |
| GeneCards | GC11P000196. |
| H-InvDB | HIX0022850. |
| HGNC | HGNC:19905. ODF3. |
| HPA | HPA039241. |
| MIM | 608356. gene. |
| neXtProt | NX_Q96PU9. |
| PharmGKB | PA134952791. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG17873. |
| GeneTree | ENSGT00440000039820. |
| HOGENOM | HBG445401. |
| HOVERGEN | HBG054464. |
| InParanoid | Q96PU9. |
| OMA | FDSAPSH. |
| OrthoDB | EOG4QC165. |
| PhylomeDB | Q96PU9. |
Gene expression databases | |
| ArrayExpress | Q96PU9. |
| Bgee | Q96PU9. |
| CleanEx | HS_ODF3. |
| Genevestigator | Q96PU9. |
Family and domain databases | |
| InterPro | IPR010736. DUF1309. [Graphical view] |
| Pfam | PF07004. DUF1309. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 78898. |
| SOURCE | Search... |
Entry information
| Entry name | ODF3A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96PU9 Secondary accession number(s): Q69YX0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with