Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96PU8

- QKI_HUMAN

UniProt

Q96PU8 - QKI_HUMAN

Protein

Protein quaking

Gene

QKI

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor By similarity.By similarity

    GO - Molecular functioni

    1. poly(A) RNA binding Source: UniProtKB
    2. protein binding Source: IntAct

    GO - Biological processi

    1. long-chain fatty acid biosynthetic process Source: Ensembl
    2. mRNA processing Source: UniProtKB-KW
    3. mRNA transport Source: UniProtKB-KW
    4. muscle cell differentiation Source: Ensembl
    5. myelination Source: Ensembl
    6. positive regulation of gene expression Source: Ensembl
    7. regulation of translation Source: UniProtKB-KW
    8. RNA splicing Source: UniProtKB-KW
    9. spermatid development Source: Ensembl
    10. vasculogenesis Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, mRNA processing, mRNA splicing, mRNA transport, Translation regulation, Transport

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein quaking
    Short name:
    Hqk
    Short name:
    HqkI
    Gene namesi
    Name:QKI
    Synonyms:HKQ
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21100. QKI.

    Subcellular locationi

    Nucleus By similarity. Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134912180.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 341341Protein quakingPRO_0000239373Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei242 – 2421Asymmetric dimethylarginine; by CARM12 Publications

    Post-translational modificationi

    Methylated by PRMT1.By similarity
    Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA By similarity.By similarity

    Keywords - PTMi

    Methylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ96PU8.
    PaxDbiQ96PU8.
    PRIDEiQ96PU8.

    PTM databases

    PhosphoSiteiQ96PU8.

    Expressioni

    Tissue specificityi

    Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.1 Publication

    Gene expression databases

    ArrayExpressiQ96PU8.
    BgeeiQ96PU8.
    GenevestigatoriQ96PU8.

    Organism-specific databases

    HPAiCAB022602.
    HPA019123.

    Interactioni

    Subunit structurei

    Homodimer. Does not require RNA to homodimerize. Able to heterodimerize with BICC1 By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CARM1Q86X552EBI-945792,EBI-2339854
    HNRNPKP619783EBI-945792,EBI-304185
    PCBP1Q153652EBI-945792,EBI-946095
    PTBP1P265993EBI-945792,EBI-350540
    RBFOX1Q9NWB12EBI-945792,EBI-945906
    RBFOX2O432513EBI-945792,EBI-746056
    RBPMSQ930622EBI-945792,EBI-740322

    Protein-protein interaction databases

    BioGridi114834. 52 interactions.
    IntActiQ96PU8. 29 interactions.
    MINTiMINT-1445480.

    Structurei

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4JVHX-ray3.50A7-204[»]
    ProteinModelPortaliQ96PU8.
    SMRiQ96PU8. Positions 12-214.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini87 – 15367KHAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi276 – 2794SH3-binding
    Motifi324 – 3307Nuclear localization signalBy similarity

    Sequence similaritiesi

    Contains 1 KH domain.Curated

    Keywords - Domaini

    SH3-binding

    Phylogenomic databases

    eggNOGiCOG5176.
    HOVERGENiHBG093883.
    InParanoidiQ96PU8.
    KOiK14945.
    OMAiESETGCK.
    OrthoDBiEOG75MVX3.
    PhylomeDBiQ96PU8.
    TreeFamiTF314878.

    Family and domain databases

    Gene3Di3.30.1370.10. 1 hit.
    InterProiIPR004087. KH_dom.
    IPR004088. KH_dom_type_1.
    [Graphical view]
    PfamiPF00013. KH_1. 1 hit.
    [Graphical view]
    SMARTiSM00322. KH. 1 hit.
    [Graphical view]
    SUPFAMiSSF54791. SSF54791. 1 hit.

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96PU8-1) [UniParc]FASTAAdd to Basket

    Also known as: HQK-5, QKI-5

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVGEMETKEK PKPTPDYLMQ LMNDKKLMSS LPNFCGIFNH LERLLDEEIS    50
    RVRKDMYNDT LNGSTEKRSA ELPDAVGPIV QLQEKLYVPV KEYPDFNFVG 100
    RILGPRGLTA KQLEAETGCK IMVRGKGSMR DKKKEEQNRG KPNWEHLNED 150
    LHVLITVEDA QNRAEIKLKR AVEEVKKLLV PAAEGEDSLK KMQLMELAIL 200
    NGTYRDANIK SPALAFSLAA TAQAAPRIIT GPAPVLPPAA LRTPTPAGPT 250
    IMPLIRQIQT AVMPNGTPHP TAAIVPPGPE AGLIYTPYEY PYTLAPATSI 300
    LEYPIEPSGV LGAVATKVRR HDMRVHPYQR IVTADRAATG N 341
    Length:341
    Mass (Da):37,671
    Last modified:December 1, 2001 - v1
    Checksum:i43E7F3A426A494C4
    GO
    Isoform 2 (identifier: Q96PU8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         213-220: Missing.

    Show »
    Length:333
    Mass (Da):36,926
    Checksum:i920353FF3C2B7403
    GO
    Isoform 3 (identifier: Q96PU8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         213-220: Missing.
         312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

    Show »
    Length:317
    Mass (Da):35,233
    Checksum:iDB23E1D2573820DF
    GO
    Isoform 4 (identifier: Q96PU8-6) [UniParc]FASTAAdd to Basket

    Also known as: HQK-7

    The sequence of this isoform differs from the canonical sequence as follows:
         312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

    Show »
    Length:325
    Mass (Da):35,978
    Checksum:iB4B2DA898F0145B3
    GO
    Isoform 5 (identifier: Q96PU8-8) [UniParc]FASTAAdd to Basket

    Also known as: HQK-7B

    The sequence of this isoform differs from the canonical sequence as follows:
         312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GKFFSPWG

    Show »
    Length:319
    Mass (Da):35,248
    Checksum:iD152389660BB4147
    GO
    Isoform 6 (identifier: Q96PU8-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GMAFPTKG

    Note: No experimental confirmation available.

    Show »
    Length:319
    Mass (Da):35,131
    Checksum:iD1427E54B0BF54E7
    GO

    Sequence cautioni

    The sequence AAF63412.1 differs from that shown. Reason: Chimeric cDNA.
    The sequence AAF63413.1 differs from that shown. Reason: Cloning artifact in N-terminus.
    The sequence AAF63414.1 differs from that shown. Reason: Cloning artifact in N-terminus.
    The sequence AAF63415.1 differs from that shown. Reason: Chimeric cDNA.
    The sequence AAF63416.1 differs from that shown. Reason: Chimeric cDNA.
    The sequence AAF63417.1 differs from that shown. Reason: Cloning artifact in N-terminus.
    The sequence AAF63413.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF63414.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAF63417.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAB55032.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti30 – 301S → G in ABC88600. 1 PublicationCurated
    Sequence conflicti208 – 2081N → D in AAH12222. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti336 – 3361R → Q in a colorectal cancer sample; somatic mutation. 1 Publication
    VAR_036051

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei213 – 2208Missing in isoform 2 and isoform 3. 1 PublicationVSP_019188
    Alternative sequencei312 – 34130GAVAT…AATGN → EWIEMPVMPDISAH in isoform 3 and isoform 4. 3 PublicationsVSP_019190Add
    BLAST
    Alternative sequencei312 – 34130GAVAT…AATGN → GKFFSPWG in isoform 5. 1 PublicationVSP_019191Add
    BLAST
    Alternative sequencei312 – 34130GAVAT…AATGN → GMAFPTKG in isoform 6. 1 PublicationVSP_019189Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067798 mRNA. Translation: BAB69496.1.
    AB067799 mRNA. Translation: BAB69497.1.
    AB067800 mRNA. Translation: BAB69498.1.
    AB067801 mRNA. Translation: BAB69499.1.
    AB067808 Genomic DNA. Translation: BAB69681.1.
    AF142417 mRNA. Translation: AAF63412.1. Sequence problems.
    AF142418 mRNA. Translation: AAF63413.1. Sequence problems.
    AF142419 mRNA. Translation: AAF63414.1. Sequence problems.
    AF142420 mRNA. Translation: AAF63415.1. Sequence problems.
    AF142421 mRNA. Translation: AAF63416.1. Sequence problems.
    AF142422 mRNA. Translation: AAF63417.1. Sequence problems.
    AY780788 mRNA. Translation: AAV98358.1.
    DQ323998 mRNA. Translation: ABC88600.1.
    AL356119, AL031781 Genomic DNA. Translation: CAI23022.1.
    AL356119, AL031781 Genomic DNA. Translation: CAI23023.1.
    AL356119, AL031781 Genomic DNA. Translation: CAI23024.1.
    AL031781, AL356119 Genomic DNA. Translation: CAI21651.1.
    AL031781, AL356119 Genomic DNA. Translation: CAI21652.1.
    AL031781, AL356119 Genomic DNA. Translation: CAI21653.1.
    BC012222 mRNA. Translation: AAH12222.1.
    BC019917 mRNA. Translation: AAH19917.1.
    AK027309 mRNA. Translation: BAB55032.1. Different initiation.
    CCDSiCCDS43525.1. [Q96PU8-8]
    CCDS5285.1. [Q96PU8-1]
    CCDS5286.1. [Q96PU8-9]
    CCDS5287.1. [Q96PU8-6]
    RefSeqiNP_006766.1. NM_006775.2. [Q96PU8-1]
    NP_996735.1. NM_206853.2. [Q96PU8-9]
    NP_996736.1. NM_206854.2. [Q96PU8-6]
    NP_996737.1. NM_206855.2. [Q96PU8-8]
    XP_005267281.1. XM_005267224.1. [Q96PU8-3]
    UniGeneiHs.510324.

    Genome annotation databases

    EnsembliENST00000275262; ENSP00000275262; ENSG00000112531. [Q96PU8-6]
    ENST00000361195; ENSP00000354867; ENSG00000112531. [Q96PU8-3]
    ENST00000361752; ENSP00000355094; ENSG00000112531. [Q96PU8-1]
    ENST00000361758; ENSP00000354951; ENSG00000112531. [Q96PU8-9]
    ENST00000392127; ENSP00000375973; ENSG00000112531. [Q96PU8-8]
    ENST00000424802; ENSP00000408382; ENSG00000112531. [Q96PU8-5]
    ENST00000453779; ENSP00000408775; ENSG00000112531. [Q96PU8-9]
    GeneIDi9444.
    KEGGihsa:9444.
    UCSCiuc003que.3. human. [Q96PU8-8]
    uc003quf.3. human. [Q96PU8-6]
    uc003qug.3. human. [Q96PU8-9]
    uc003quh.3. human. [Q96PU8-5]
    uc003qui.3. human. [Q96PU8-1]
    uc003quj.3. human. [Q96PU8-3]

    Polymorphism databases

    DMDMi74761039.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067798 mRNA. Translation: BAB69496.1 .
    AB067799 mRNA. Translation: BAB69497.1 .
    AB067800 mRNA. Translation: BAB69498.1 .
    AB067801 mRNA. Translation: BAB69499.1 .
    AB067808 Genomic DNA. Translation: BAB69681.1 .
    AF142417 mRNA. Translation: AAF63412.1 . Sequence problems.
    AF142418 mRNA. Translation: AAF63413.1 . Sequence problems.
    AF142419 mRNA. Translation: AAF63414.1 . Sequence problems.
    AF142420 mRNA. Translation: AAF63415.1 . Sequence problems.
    AF142421 mRNA. Translation: AAF63416.1 . Sequence problems.
    AF142422 mRNA. Translation: AAF63417.1 . Sequence problems.
    AY780788 mRNA. Translation: AAV98358.1 .
    DQ323998 mRNA. Translation: ABC88600.1 .
    AL356119 , AL031781 Genomic DNA. Translation: CAI23022.1 .
    AL356119 , AL031781 Genomic DNA. Translation: CAI23023.1 .
    AL356119 , AL031781 Genomic DNA. Translation: CAI23024.1 .
    AL031781 , AL356119 Genomic DNA. Translation: CAI21651.1 .
    AL031781 , AL356119 Genomic DNA. Translation: CAI21652.1 .
    AL031781 , AL356119 Genomic DNA. Translation: CAI21653.1 .
    BC012222 mRNA. Translation: AAH12222.1 .
    BC019917 mRNA. Translation: AAH19917.1 .
    AK027309 mRNA. Translation: BAB55032.1 . Different initiation.
    CCDSi CCDS43525.1. [Q96PU8-8 ]
    CCDS5285.1. [Q96PU8-1 ]
    CCDS5286.1. [Q96PU8-9 ]
    CCDS5287.1. [Q96PU8-6 ]
    RefSeqi NP_006766.1. NM_006775.2. [Q96PU8-1 ]
    NP_996735.1. NM_206853.2. [Q96PU8-9 ]
    NP_996736.1. NM_206854.2. [Q96PU8-6 ]
    NP_996737.1. NM_206855.2. [Q96PU8-8 ]
    XP_005267281.1. XM_005267224.1. [Q96PU8-3 ]
    UniGenei Hs.510324.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4JVH X-ray 3.50 A 7-204 [» ]
    ProteinModelPortali Q96PU8.
    SMRi Q96PU8. Positions 12-214.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 114834. 52 interactions.
    IntActi Q96PU8. 29 interactions.
    MINTi MINT-1445480.

    PTM databases

    PhosphoSitei Q96PU8.

    Polymorphism databases

    DMDMi 74761039.

    Proteomic databases

    MaxQBi Q96PU8.
    PaxDbi Q96PU8.
    PRIDEi Q96PU8.

    Protocols and materials databases

    DNASUi 9444.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000275262 ; ENSP00000275262 ; ENSG00000112531 . [Q96PU8-6 ]
    ENST00000361195 ; ENSP00000354867 ; ENSG00000112531 . [Q96PU8-3 ]
    ENST00000361752 ; ENSP00000355094 ; ENSG00000112531 . [Q96PU8-1 ]
    ENST00000361758 ; ENSP00000354951 ; ENSG00000112531 . [Q96PU8-9 ]
    ENST00000392127 ; ENSP00000375973 ; ENSG00000112531 . [Q96PU8-8 ]
    ENST00000424802 ; ENSP00000408382 ; ENSG00000112531 . [Q96PU8-5 ]
    ENST00000453779 ; ENSP00000408775 ; ENSG00000112531 . [Q96PU8-9 ]
    GeneIDi 9444.
    KEGGi hsa:9444.
    UCSCi uc003que.3. human. [Q96PU8-8 ]
    uc003quf.3. human. [Q96PU8-6 ]
    uc003qug.3. human. [Q96PU8-9 ]
    uc003quh.3. human. [Q96PU8-5 ]
    uc003qui.3. human. [Q96PU8-1 ]
    uc003quj.3. human. [Q96PU8-3 ]

    Organism-specific databases

    CTDi 9444.
    GeneCardsi GC06P163835.
    HGNCi HGNC:21100. QKI.
    HPAi CAB022602.
    HPA019123.
    MIMi 609590. gene.
    neXtProti NX_Q96PU8.
    PharmGKBi PA134912180.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5176.
    HOVERGENi HBG093883.
    InParanoidi Q96PU8.
    KOi K14945.
    OMAi ESETGCK.
    OrthoDBi EOG75MVX3.
    PhylomeDBi Q96PU8.
    TreeFami TF314878.

    Miscellaneous databases

    ChiTaRSi QKI. human.
    GeneWikii QKI.
    GenomeRNAii 9444.
    NextBioi 35368.
    PROi Q96PU8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96PU8.
    Bgeei Q96PU8.
    Genevestigatori Q96PU8.

    Family and domain databases

    Gene3Di 3.30.1370.10. 1 hit.
    InterProi IPR004087. KH_dom.
    IPR004088. KH_dom_type_1.
    [Graphical view ]
    Pfami PF00013. KH_1. 1 hit.
    [Graphical view ]
    SMARTi SM00322. KH. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54791. SSF54791. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Expression of Hqk encoding a KH RNA binding protein is altered in human glioma."
      Li Z.Z., Kondo T., Murata T., Ebersole T.A., Nishi T., Tada K., Ushio Y., Yamamura K., Abe K.
      Jpn. J. Cancer Res. 93:167-177(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 4 AND 5).
      Tissue: Brain.
    2. "Molecular cloning of human QUAKING gene."
      Xia J.-H., Xiao J.-F., He Y.-G., Yu K.-P., Pan Q., Dai H.-P.
      Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 6).
    3. Li H., Nong W., Zhou G., Ke R., Shen C., Zhong G., Liang M., Tang Z., Huang B., Lin L., Yang S.
      Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 3).
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta and Skin.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-341 (ISOFORM 1).
      Tissue: Embryo.
    7. "Sam68 RNA binding protein is an in vivo substrate for protein arginine N-methyltransferase 1."
      Cote J., Boisvert F.-M., Boulanger M.-C., Bedford M.T., Richard S.
      Mol. Biol. Cell 14:274-287(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: METHYLATION.
    8. Cited for: TISSUE SPECIFICITY.
    9. "Human QKI, a potential regulator of mRNA expression of human oligodendrocyte-related genes involved in schizophrenia."
      Aberg K., Saetre P., Jareborg N., Jazin E.
      Proc. Natl. Acad. Sci. U.S.A. 103:7482-7487(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION AS REGULATOR OF OLIGODENDROCYTE DIFFERENTIATION.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. Cited for: METHYLATION AT ARG-242 BY CARM1.
    12. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-336.

    Entry informationi

    Entry nameiQKI_HUMAN
    AccessioniPrimary (citable) accession number: Q96PU8
    Secondary accession number(s): Q2I375
    , Q5MJQ1, Q969L9, Q96EJ3, Q96KA3, Q96PU6, Q96PU7, Q9P0X6, Q9P0X7, Q9P0X8, Q9P0X9, Q9P0Y0, Q9P0Y1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 13, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3