Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96PU8 (QKI_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein quaking

Short name=Hqk
Short name=HqkI
Gene names
Name:QKI
Synonyms:HKQ
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length341 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor By similarity. Ref.9

Subunit structure

Homodimer. Does not require RNA to homodimerize. Able to heterodimerize with BICC1 By similarity.

Subcellular location

Nucleus By similarity. Cytoplasm By similarity.

Tissue specificity

Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients. Ref.8

Post-translational modification

Methylated by PRMT1 By similarity. Ref.7 Ref.11

Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA By similarity.

Sequence similarities

Contains 1 KH domain.

Sequence caution

The sequence AAF63412.1 differs from that shown. Reason: Chimeric cDNA.

The sequence AAF63413.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAF63413.1 differs from that shown. Reason: Cloning artifact in N-terminus.

The sequence AAF63414.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAF63414.1 differs from that shown. Reason: Cloning artifact in N-terminus.

The sequence AAF63415.1 differs from that shown. Reason: Chimeric cDNA.

The sequence AAF63416.1 differs from that shown. Reason: Chimeric cDNA.

The sequence AAF63417.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence AAF63417.1 differs from that shown. Reason: Cloning artifact in N-terminus.

The sequence BAB55032.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Biological processDifferentiation
mRNA processing
mRNA splicing
mRNA transport
Translation regulation
Transport
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSH3-binding
   LigandRNA-binding
   Molecular functionDevelopmental protein
   PTMMethylation
Phosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processRNA splicing

Inferred from electronic annotation. Source: UniProtKB-KW

long-chain fatty acid biosynthetic process

Inferred from electronic annotation. Source: Ensembl

mRNA processing

Inferred from electronic annotation. Source: UniProtKB-KW

mRNA transport

Inferred from electronic annotation. Source: UniProtKB-KW

muscle cell differentiation

Inferred from electronic annotation. Source: Ensembl

myelination

Inferred from electronic annotation. Source: Ensembl

positive regulation of gene expression

Inferred from electronic annotation. Source: Ensembl

regulation of translation

Inferred from electronic annotation. Source: UniProtKB-KW

spermatid development

Inferred from electronic annotation. Source: Ensembl

vasculogenesis

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionpoly(A) RNA binding

Inferred from direct assay PubMed 22681889. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 6 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96PU8-1)

Also known as: HQK-5; QKI-5;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96PU8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.
Isoform 3 (identifier: Q96PU8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH
Isoform 4 (identifier: Q96PU8-6)

Also known as: HQK-7;

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH
Isoform 5 (identifier: Q96PU8-8)

Also known as: HQK-7B;

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GKFFSPWG
Isoform 6 (identifier: Q96PU8-9)

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GMAFPTKG
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 341341Protein quaking
PRO_0000239373

Regions

Domain87 – 15367KH
Motif276 – 2794SH3-binding
Motif324 – 3307Nuclear localization signal By similarity

Amino acid modifications

Modified residue2421Asymmetric dimethylarginine; by CARM1 Ref.11

Natural variations

Alternative sequence213 – 2208Missing in isoform 2 and isoform 3.
VSP_019188
Alternative sequence312 – 34130GAVAT…AATGN → EWIEMPVMPDISAH in isoform 3 and isoform 4.
VSP_019190
Alternative sequence312 – 34130GAVAT…AATGN → GKFFSPWG in isoform 5.
VSP_019191
Alternative sequence312 – 34130GAVAT…AATGN → GMAFPTKG in isoform 6.
VSP_019189
Natural variant3361R → Q in a colorectal cancer sample; somatic mutation. Ref.12
VAR_036051

Experimental info

Sequence conflict301S → G in ABC88600. Ref.3
Sequence conflict2081N → D in AAH12222. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (HQK-5) (QKI-5) [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 43E7F3A426A494C4

FASTA34137,671
        10         20         30         40         50         60 
MVGEMETKEK PKPTPDYLMQ LMNDKKLMSS LPNFCGIFNH LERLLDEEIS RVRKDMYNDT 

        70         80         90        100        110        120 
LNGSTEKRSA ELPDAVGPIV QLQEKLYVPV KEYPDFNFVG RILGPRGLTA KQLEAETGCK 

       130        140        150        160        170        180 
IMVRGKGSMR DKKKEEQNRG KPNWEHLNED LHVLITVEDA QNRAEIKLKR AVEEVKKLLV 

       190        200        210        220        230        240 
PAAEGEDSLK KMQLMELAIL NGTYRDANIK SPALAFSLAA TAQAAPRIIT GPAPVLPPAA 

       250        260        270        280        290        300 
LRTPTPAGPT IMPLIRQIQT AVMPNGTPHP TAAIVPPGPE AGLIYTPYEY PYTLAPATSI 

       310        320        330        340 
LEYPIEPSGV LGAVATKVRR HDMRVHPYQR IVTADRAATG N 

« Hide

Isoform 2 [UniParc].

Checksum: 920353FF3C2B7403
Show »

FASTA33336,926
Isoform 3 [UniParc].

Checksum: DB23E1D2573820DF
Show »

FASTA31735,233
Isoform 4 (HQK-7) [UniParc].

Checksum: B4B2DA898F0145B3
Show »

FASTA32535,978
Isoform 5 (HQK-7B) [UniParc].

Checksum: D152389660BB4147
Show »

FASTA31935,248
Isoform 6 [UniParc].

Checksum: D1427E54B0BF54E7
Show »

FASTA31935,131

References

« Hide 'large scale' references
[1]"Expression of Hqk encoding a KH RNA binding protein is altered in human glioma."
Li Z.Z., Kondo T., Murata T., Ebersole T.A., Nishi T., Tada K., Ushio Y., Yamamura K., Abe K.
Jpn. J. Cancer Res. 93:167-177(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 4 AND 5).
Tissue: Brain.
[2]"Molecular cloning of human QUAKING gene."
Xia J.-H., Xiao J.-F., He Y.-G., Yu K.-P., Pan Q., Dai H.-P.
Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 6).
[3]Li H., Nong W., Zhou G., Ke R., Shen C., Zhong G., Liang M., Tang Z., Huang B., Lin L., Yang S.
Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 3).
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta and Skin.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-341 (ISOFORM 1).
Tissue: Embryo.
[7]"Sam68 RNA binding protein is an in vivo substrate for protein arginine N-methyltransferase 1."
Cote J., Boisvert F.-M., Boulanger M.-C., Bedford M.T., Richard S.
Mol. Biol. Cell 14:274-287(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: METHYLATION.
[8]"Human QKI, a new candidate gene for schizophrenia involved in myelination."
Aeberg K., Saetre P., Lindholm E., Ekholm B., Pettersson U., Adolfsson R., Jazin E.
Am. J. Med. Genet. B Neuropsychiatr. Genet. 141:84-90(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"Human QKI, a potential regulator of mRNA expression of human oligodendrocyte-related genes involved in schizophrenia."
Aberg K., Saetre P., Jareborg N., Jazin E.
Proc. Natl. Acad. Sci. U.S.A. 103:7482-7487(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION AS REGULATOR OF OLIGODENDROCYTE DIFFERENTIATION.
[10]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"A Y2H-seq approach defines the human protein methyltransferase interactome."
Weimann M., Grossmann A., Woodsmith J., Ozkan Z., Birth P., Meierhofer D., Benlasfer N., Valovka T., Timmermann B., Wanker E.E., Sauer S., Stelzl U.
Nat. Methods 10:339-342(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: METHYLATION AT ARG-242 BY CARM1.
[12]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-336.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB067798 mRNA. Translation: BAB69496.1.
AB067799 mRNA. Translation: BAB69497.1.
AB067800 mRNA. Translation: BAB69498.1.
AB067801 mRNA. Translation: BAB69499.1.
AB067808 Genomic DNA. Translation: BAB69681.1.
AF142417 mRNA. Translation: AAF63412.1. Sequence problems.
AF142418 mRNA. Translation: AAF63413.1. Sequence problems.
AF142419 mRNA. Translation: AAF63414.1. Sequence problems.
AF142420 mRNA. Translation: AAF63415.1. Sequence problems.
AF142421 mRNA. Translation: AAF63416.1. Sequence problems.
AF142422 mRNA. Translation: AAF63417.1. Sequence problems.
AY780788 mRNA. Translation: AAV98358.1.
DQ323998 mRNA. Translation: ABC88600.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23022.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23023.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23024.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21651.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21652.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21653.1.
BC012222 mRNA. Translation: AAH12222.1.
BC019917 mRNA. Translation: AAH19917.1.
AK027309 mRNA. Translation: BAB55032.1. Different initiation.
RefSeqNP_006766.1. NM_006775.2.
NP_996735.1. NM_206853.2.
NP_996736.1. NM_206854.2.
NP_996737.1. NM_206855.2.
XP_005267281.1. XM_005267224.1.
UniGeneHs.510324.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4JVHX-ray3.50A7-214[»]
ProteinModelPortalQ96PU8.
SMRQ96PU8. Positions 12-214.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid114834. 52 interactions.
IntActQ96PU8. 29 interactions.
MINTMINT-1445480.

PTM databases

PhosphoSiteQ96PU8.

Polymorphism databases

DMDM74761039.

Proteomic databases

PaxDbQ96PU8.
PRIDEQ96PU8.

Protocols and materials databases

DNASU9444.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000275262; ENSP00000275262; ENSG00000112531. [Q96PU8-6]
ENST00000361195; ENSP00000354867; ENSG00000112531. [Q96PU8-3]
ENST00000361752; ENSP00000355094; ENSG00000112531. [Q96PU8-1]
ENST00000361758; ENSP00000354951; ENSG00000112531. [Q96PU8-9]
ENST00000392127; ENSP00000375973; ENSG00000112531. [Q96PU8-8]
ENST00000424802; ENSP00000408382; ENSG00000112531. [Q96PU8-5]
ENST00000453779; ENSP00000408775; ENSG00000112531. [Q96PU8-9]
GeneID9444.
KEGGhsa:9444.
UCSCuc003que.3. human. [Q96PU8-8]
uc003quf.3. human. [Q96PU8-6]
uc003qug.3. human. [Q96PU8-9]
uc003quh.3. human. [Q96PU8-5]
uc003qui.3. human. [Q96PU8-1]
uc003quj.3. human. [Q96PU8-3]

Organism-specific databases

CTD9444.
GeneCardsGC06P163835.
HGNCHGNC:21100. QKI.
HPACAB022602.
HPA019123.
MIM609590. gene.
neXtProtNX_Q96PU8.
PharmGKBPA134912180.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5176.
HOVERGENHBG093883.
InParanoidQ96PU8.
KOK14945.
OMAESETGCK.
OrthoDBEOG75MVX3.
PhylomeDBQ96PU8.
TreeFamTF314878.

Gene expression databases

ArrayExpressQ96PU8.
BgeeQ96PU8.
GenevestigatorQ96PU8.

Family and domain databases

Gene3D3.30.1370.10. 1 hit.
InterProIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view]
PfamPF00013. KH_1. 1 hit.
[Graphical view]
SMARTSM00322. KH. 1 hit.
[Graphical view]
SUPFAMSSF54791. SSF54791. 1 hit.
ProtoNetSearch...

Other

ChiTaRSQKI. human.
GeneWikiQKI.
GenomeRNAi9444.
NextBio35368.
PROQ96PU8.
SOURCESearch...

Entry information

Entry nameQKI_HUMAN
AccessionPrimary (citable) accession number: Q96PU8
Secondary accession number(s): Q2I375 expand/collapse secondary AC list , Q5MJQ1, Q969L9, Q96EJ3, Q96KA3, Q96PU6, Q96PU7, Q9P0X6, Q9P0X7, Q9P0X8, Q9P0X9, Q9P0Y0, Q9P0Y1
Entry history
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM