SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96PU8

- QKI_HUMAN

UniProt

Q96PU8 - QKI_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein quaking

Gene
QKI, HKQ
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Acts by regulating pre-mRNA splicing, mRNA export, mRNA stability and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor By similarity.1 Publication

GO - Molecular functioni

  1. poly(A) RNA binding Source: UniProtKB
  2. protein binding Source: IntAct

GO - Biological processi

  1. long-chain fatty acid biosynthetic process Source: Ensembl
  2. mRNA processing Source: UniProtKB-KW
  3. mRNA transport Source: UniProtKB-KW
  4. muscle cell differentiation Source: Ensembl
  5. myelination Source: Ensembl
  6. positive regulation of gene expression Source: Ensembl
  7. regulation of translation Source: UniProtKB-KW
  8. RNA splicing Source: UniProtKB-KW
  9. spermatid development Source: Ensembl
  10. vasculogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, mRNA processing, mRNA splicing, mRNA transport, Translation regulation, Transport

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein quaking
Short name:
Hqk
Short name:
HqkI
Gene namesi
Name:QKI
Synonyms:HKQ
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21100. QKI.

Subcellular locationi

Nucleus By similarity. Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134912180.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 341341Protein quakingPRO_0000239373Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei242 – 2421Asymmetric dimethylarginine; by CARM11 Publication

Post-translational modificationi

Methylated by PRMT1 By similarity.2 Publications
Tyrosine phosphorylated at its C-terminus, probably by FYN. Phosphorylation leads to decreased mRNA-binding affinity, affecting transport and/or stabilization of MBP mRNA By similarity.

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

MaxQBiQ96PU8.
PaxDbiQ96PU8.
PRIDEiQ96PU8.

PTM databases

PhosphoSiteiQ96PU8.

Expressioni

Tissue specificityi

Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.1 Publication

Gene expression databases

ArrayExpressiQ96PU8.
BgeeiQ96PU8.
GenevestigatoriQ96PU8.

Organism-specific databases

HPAiCAB022602.
HPA019123.

Interactioni

Subunit structurei

Homodimer. Does not require RNA to homodimerize. Able to heterodimerize with BICC1 By similarity.

Binary interactionsi

WithEntry#Exp.IntActNotes
CARM1Q86X552EBI-945792,EBI-2339854
HNRNPKP619783EBI-945792,EBI-304185
PCBP1Q153652EBI-945792,EBI-946095
PTBP1P265993EBI-945792,EBI-350540
RBFOX1Q9NWB12EBI-945792,EBI-945906
RBFOX2O432513EBI-945792,EBI-746056
RBPMSQ930622EBI-945792,EBI-740322

Protein-protein interaction databases

BioGridi114834. 52 interactions.
IntActiQ96PU8. 29 interactions.
MINTiMINT-1445480.

Structurei

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4JVHX-ray3.50A7-204[»]
ProteinModelPortaliQ96PU8.
SMRiQ96PU8. Positions 12-214.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini87 – 15367KHAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi276 – 2794SH3-binding
Motifi324 – 3307Nuclear localization signal By similarity

Sequence similaritiesi

Contains 1 KH domain.

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiCOG5176.
HOVERGENiHBG093883.
InParanoidiQ96PU8.
KOiK14945.
OMAiESETGCK.
OrthoDBiEOG75MVX3.
PhylomeDBiQ96PU8.
TreeFamiTF314878.

Family and domain databases

Gene3Di3.30.1370.10. 1 hit.
InterProiIPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view]
PfamiPF00013. KH_1. 1 hit.
[Graphical view]
SMARTiSM00322. KH. 1 hit.
[Graphical view]
SUPFAMiSSF54791. SSF54791. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96PU8-1) [UniParc]FASTAAdd to Basket

Also known as: HQK-5, QKI-5

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVGEMETKEK PKPTPDYLMQ LMNDKKLMSS LPNFCGIFNH LERLLDEEIS    50
RVRKDMYNDT LNGSTEKRSA ELPDAVGPIV QLQEKLYVPV KEYPDFNFVG 100
RILGPRGLTA KQLEAETGCK IMVRGKGSMR DKKKEEQNRG KPNWEHLNED 150
LHVLITVEDA QNRAEIKLKR AVEEVKKLLV PAAEGEDSLK KMQLMELAIL 200
NGTYRDANIK SPALAFSLAA TAQAAPRIIT GPAPVLPPAA LRTPTPAGPT 250
IMPLIRQIQT AVMPNGTPHP TAAIVPPGPE AGLIYTPYEY PYTLAPATSI 300
LEYPIEPSGV LGAVATKVRR HDMRVHPYQR IVTADRAATG N 341
Length:341
Mass (Da):37,671
Last modified:December 1, 2001 - v1
Checksum:i43E7F3A426A494C4
GO
Isoform 2 (identifier: Q96PU8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.

Show »
Length:333
Mass (Da):36,926
Checksum:i920353FF3C2B7403
GO
Isoform 3 (identifier: Q96PU8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-220: Missing.
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

Show »
Length:317
Mass (Da):35,233
Checksum:iDB23E1D2573820DF
GO
Isoform 4 (identifier: Q96PU8-6) [UniParc]FASTAAdd to Basket

Also known as: HQK-7

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → EWIEMPVMPDISAH

Show »
Length:325
Mass (Da):35,978
Checksum:iB4B2DA898F0145B3
GO
Isoform 5 (identifier: Q96PU8-8) [UniParc]FASTAAdd to Basket

Also known as: HQK-7B

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GKFFSPWG

Show »
Length:319
Mass (Da):35,248
Checksum:iD152389660BB4147
GO
Isoform 6 (identifier: Q96PU8-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     312-341: GAVATKVRRHDMRVHPYQRIVTADRAATGN → GMAFPTKG

Note: No experimental confirmation available.

Show »
Length:319
Mass (Da):35,131
Checksum:iD1427E54B0BF54E7
GO

Sequence cautioni

The sequence AAF63412.1 differs from that shown. Reason: Chimeric cDNA.
The sequence AAF63413.1 differs from that shown. Reason: Cloning artifact in N-terminus.
The sequence AAF63414.1 differs from that shown. Reason: Cloning artifact in N-terminus.
The sequence AAF63415.1 differs from that shown. Reason: Chimeric cDNA.
The sequence AAF63416.1 differs from that shown. Reason: Chimeric cDNA.
The sequence AAF63417.1 differs from that shown. Reason: Cloning artifact in N-terminus.
The sequence AAF63413.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAF63414.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAF63417.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAB55032.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti336 – 3361R → Q in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_036051

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei213 – 2208Missing in isoform 2 and isoform 3. VSP_019188
Alternative sequencei312 – 34130GAVAT…AATGN → EWIEMPVMPDISAH in isoform 3 and isoform 4. VSP_019190Add
BLAST
Alternative sequencei312 – 34130GAVAT…AATGN → GKFFSPWG in isoform 5. VSP_019191Add
BLAST
Alternative sequencei312 – 34130GAVAT…AATGN → GMAFPTKG in isoform 6. VSP_019189Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti30 – 301S → G in ABC88600. 1 Publication
Sequence conflicti208 – 2081N → D in AAH12222. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067798 mRNA. Translation: BAB69496.1.
AB067799 mRNA. Translation: BAB69497.1.
AB067800 mRNA. Translation: BAB69498.1.
AB067801 mRNA. Translation: BAB69499.1.
AB067808 Genomic DNA. Translation: BAB69681.1.
AF142417 mRNA. Translation: AAF63412.1. Sequence problems.
AF142418 mRNA. Translation: AAF63413.1. Sequence problems.
AF142419 mRNA. Translation: AAF63414.1. Sequence problems.
AF142420 mRNA. Translation: AAF63415.1. Sequence problems.
AF142421 mRNA. Translation: AAF63416.1. Sequence problems.
AF142422 mRNA. Translation: AAF63417.1. Sequence problems.
AY780788 mRNA. Translation: AAV98358.1.
DQ323998 mRNA. Translation: ABC88600.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23022.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23023.1.
AL356119, AL031781 Genomic DNA. Translation: CAI23024.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21651.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21652.1.
AL031781, AL356119 Genomic DNA. Translation: CAI21653.1.
BC012222 mRNA. Translation: AAH12222.1.
BC019917 mRNA. Translation: AAH19917.1.
AK027309 mRNA. Translation: BAB55032.1. Different initiation.
CCDSiCCDS43525.1. [Q96PU8-8]
CCDS5285.1. [Q96PU8-1]
CCDS5286.1. [Q96PU8-9]
CCDS5287.1. [Q96PU8-6]
RefSeqiNP_006766.1. NM_006775.2. [Q96PU8-1]
NP_996735.1. NM_206853.2. [Q96PU8-9]
NP_996736.1. NM_206854.2. [Q96PU8-6]
NP_996737.1. NM_206855.2. [Q96PU8-8]
XP_005267281.1. XM_005267224.1. [Q96PU8-3]
UniGeneiHs.510324.

Genome annotation databases

EnsembliENST00000275262; ENSP00000275262; ENSG00000112531. [Q96PU8-6]
ENST00000361195; ENSP00000354867; ENSG00000112531. [Q96PU8-3]
ENST00000361752; ENSP00000355094; ENSG00000112531. [Q96PU8-1]
ENST00000361758; ENSP00000354951; ENSG00000112531. [Q96PU8-9]
ENST00000392127; ENSP00000375973; ENSG00000112531. [Q96PU8-8]
ENST00000424802; ENSP00000408382; ENSG00000112531. [Q96PU8-5]
ENST00000453779; ENSP00000408775; ENSG00000112531. [Q96PU8-9]
GeneIDi9444.
KEGGihsa:9444.
UCSCiuc003que.3. human. [Q96PU8-8]
uc003quf.3. human. [Q96PU8-6]
uc003qug.3. human. [Q96PU8-9]
uc003quh.3. human. [Q96PU8-5]
uc003qui.3. human. [Q96PU8-1]
uc003quj.3. human. [Q96PU8-3]

Polymorphism databases

DMDMi74761039.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067798 mRNA. Translation: BAB69496.1 .
AB067799 mRNA. Translation: BAB69497.1 .
AB067800 mRNA. Translation: BAB69498.1 .
AB067801 mRNA. Translation: BAB69499.1 .
AB067808 Genomic DNA. Translation: BAB69681.1 .
AF142417 mRNA. Translation: AAF63412.1 . Sequence problems.
AF142418 mRNA. Translation: AAF63413.1 . Sequence problems.
AF142419 mRNA. Translation: AAF63414.1 . Sequence problems.
AF142420 mRNA. Translation: AAF63415.1 . Sequence problems.
AF142421 mRNA. Translation: AAF63416.1 . Sequence problems.
AF142422 mRNA. Translation: AAF63417.1 . Sequence problems.
AY780788 mRNA. Translation: AAV98358.1 .
DQ323998 mRNA. Translation: ABC88600.1 .
AL356119 , AL031781 Genomic DNA. Translation: CAI23022.1 .
AL356119 , AL031781 Genomic DNA. Translation: CAI23023.1 .
AL356119 , AL031781 Genomic DNA. Translation: CAI23024.1 .
AL031781 , AL356119 Genomic DNA. Translation: CAI21651.1 .
AL031781 , AL356119 Genomic DNA. Translation: CAI21652.1 .
AL031781 , AL356119 Genomic DNA. Translation: CAI21653.1 .
BC012222 mRNA. Translation: AAH12222.1 .
BC019917 mRNA. Translation: AAH19917.1 .
AK027309 mRNA. Translation: BAB55032.1 . Different initiation.
CCDSi CCDS43525.1. [Q96PU8-8 ]
CCDS5285.1. [Q96PU8-1 ]
CCDS5286.1. [Q96PU8-9 ]
CCDS5287.1. [Q96PU8-6 ]
RefSeqi NP_006766.1. NM_006775.2. [Q96PU8-1 ]
NP_996735.1. NM_206853.2. [Q96PU8-9 ]
NP_996736.1. NM_206854.2. [Q96PU8-6 ]
NP_996737.1. NM_206855.2. [Q96PU8-8 ]
XP_005267281.1. XM_005267224.1. [Q96PU8-3 ]
UniGenei Hs.510324.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4JVH X-ray 3.50 A 7-204 [» ]
ProteinModelPortali Q96PU8.
SMRi Q96PU8. Positions 12-214.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 114834. 52 interactions.
IntActi Q96PU8. 29 interactions.
MINTi MINT-1445480.

PTM databases

PhosphoSitei Q96PU8.

Polymorphism databases

DMDMi 74761039.

Proteomic databases

MaxQBi Q96PU8.
PaxDbi Q96PU8.
PRIDEi Q96PU8.

Protocols and materials databases

DNASUi 9444.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000275262 ; ENSP00000275262 ; ENSG00000112531 . [Q96PU8-6 ]
ENST00000361195 ; ENSP00000354867 ; ENSG00000112531 . [Q96PU8-3 ]
ENST00000361752 ; ENSP00000355094 ; ENSG00000112531 . [Q96PU8-1 ]
ENST00000361758 ; ENSP00000354951 ; ENSG00000112531 . [Q96PU8-9 ]
ENST00000392127 ; ENSP00000375973 ; ENSG00000112531 . [Q96PU8-8 ]
ENST00000424802 ; ENSP00000408382 ; ENSG00000112531 . [Q96PU8-5 ]
ENST00000453779 ; ENSP00000408775 ; ENSG00000112531 . [Q96PU8-9 ]
GeneIDi 9444.
KEGGi hsa:9444.
UCSCi uc003que.3. human. [Q96PU8-8 ]
uc003quf.3. human. [Q96PU8-6 ]
uc003qug.3. human. [Q96PU8-9 ]
uc003quh.3. human. [Q96PU8-5 ]
uc003qui.3. human. [Q96PU8-1 ]
uc003quj.3. human. [Q96PU8-3 ]

Organism-specific databases

CTDi 9444.
GeneCardsi GC06P163835.
HGNCi HGNC:21100. QKI.
HPAi CAB022602.
HPA019123.
MIMi 609590. gene.
neXtProti NX_Q96PU8.
PharmGKBi PA134912180.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5176.
HOVERGENi HBG093883.
InParanoidi Q96PU8.
KOi K14945.
OMAi ESETGCK.
OrthoDBi EOG75MVX3.
PhylomeDBi Q96PU8.
TreeFami TF314878.

Miscellaneous databases

ChiTaRSi QKI. human.
GeneWikii QKI.
GenomeRNAii 9444.
NextBioi 35368.
PROi Q96PU8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96PU8.
Bgeei Q96PU8.
Genevestigatori Q96PU8.

Family and domain databases

Gene3Di 3.30.1370.10. 1 hit.
InterProi IPR004087. KH_dom.
IPR004088. KH_dom_type_1.
[Graphical view ]
Pfami PF00013. KH_1. 1 hit.
[Graphical view ]
SMARTi SM00322. KH. 1 hit.
[Graphical view ]
SUPFAMi SSF54791. SSF54791. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression of Hqk encoding a KH RNA binding protein is altered in human glioma."
    Li Z.Z., Kondo T., Murata T., Ebersole T.A., Nishi T., Tada K., Ushio Y., Yamamura K., Abe K.
    Jpn. J. Cancer Res. 93:167-177(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 4 AND 5).
    Tissue: Brain.
  2. "Molecular cloning of human QUAKING gene."
    Xia J.-H., Xiao J.-F., He Y.-G., Yu K.-P., Pan Q., Dai H.-P.
    Submitted (APR-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 6).
  3. Li H., Nong W., Zhou G., Ke R., Shen C., Zhong G., Liang M., Tang Z., Huang B., Lin L., Yang S.
    Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-341 (ISOFORM 3).
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Skin.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 15-341 (ISOFORM 1).
    Tissue: Embryo.
  7. "Sam68 RNA binding protein is an in vivo substrate for protein arginine N-methyltransferase 1."
    Cote J., Boisvert F.-M., Boulanger M.-C., Bedford M.T., Richard S.
    Mol. Biol. Cell 14:274-287(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: METHYLATION.
  8. Cited for: TISSUE SPECIFICITY.
  9. "Human QKI, a potential regulator of mRNA expression of human oligodendrocyte-related genes involved in schizophrenia."
    Aberg K., Saetre P., Jareborg N., Jazin E.
    Proc. Natl. Acad. Sci. U.S.A. 103:7482-7487(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION AS REGULATOR OF OLIGODENDROCYTE DIFFERENTIATION.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. Cited for: METHYLATION AT ARG-242 BY CARM1.
  12. Cited for: VARIANT [LARGE SCALE ANALYSIS] GLN-336.

Entry informationi

Entry nameiQKI_HUMAN
AccessioniPrimary (citable) accession number: Q96PU8
Secondary accession number(s): Q2I375
, Q5MJQ1, Q969L9, Q96EJ3, Q96KA3, Q96PU6, Q96PU7, Q9P0X6, Q9P0X7, Q9P0X8, Q9P0X9, Q9P0Y0, Q9P0Y1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 13, 2006
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi