SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96PQ7

- KLHL5_HUMAN

UniProt

Q96PQ7 - KLHL5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kelch-like protein 5

Gene
KLHL5
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Keywords - Ligandi

Actin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 5
Gene namesi
Name:KLHL5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:6356. KLHL5.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. cytoskeleton Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30146.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 755755Kelch-like protein 5PRO_0000119105Add
BLAST

Proteomic databases

MaxQBiQ96PQ7.
PaxDbiQ96PQ7.
PRIDEiQ96PQ7.

PTM databases

PhosphoSiteiQ96PQ7.

Expressioni

Tissue specificityi

Expressed in adrenal gland, ovary and thyroid gland and less abundantly in lymph node, prostate, spinal chord, testis and trachea.

Gene expression databases

ArrayExpressiQ96PQ7.
BgeeiQ96PQ7.
CleanExiHS_KLHL5.
GenevestigatoriQ96PQ7.

Organism-specific databases

HPAiHPA013958.

Interactioni

Protein-protein interaction databases

BioGridi119278. 7 interactions.
IntActiQ96PQ7. 12 interactions.
MINTiMINT-6780713.
STRINGi9606.ENSP00000371358.

Structurei

3D structure databases

ProteinModelPortaliQ96PQ7.
SMRiQ96PQ7. Positions 195-447, 467-753.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini220 – 28768BTBAdd
BLAST
Repeati468 – 51447Kelch 1Add
BLAST
Repeati515 – 56147Kelch 2Add
BLAST
Repeati563 – 60846Kelch 3Add
BLAST
Repeati609 – 65547Kelch 4Add
BLAST
Repeati657 – 70852Kelch 5Add
BLAST
Repeati709 – 75446Kelch 6Add
BLAST

Sequence similaritiesi

Contains 1 BTB (POZ) domain.
Contains 6 Kelch repeats.

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiNOG280486.
HOVERGENiHBG014286.
KOiK10442.
OMAiCTSDEFF.
OrthoDBiEOG7ZWD17.
PhylomeDBiQ96PQ7.
TreeFamiTF329218.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
3.30.710.10. 1 hit.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96PQ7-1) [UniParc]FASTAAdd to Basket

Also known as: KLHL5a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MNVIYFPLHI FVVYSRAYTS LVLVGCTNLC AVLFARCLDD HLVSLRMSGS    50
RKEFDVKQIL KIRWRWFGHQ ASSPNSTVDS QQGEFWNRGQ TGANGGRKFL 100
DPCSLQLPLA SIGYRRSSQL DFQNSPSWPM ASTSEVPAFE FTAEDCGGAH 150
WLDRPEVDDG TSEEENESDS SSCRTSNSSQ TLSSCHTMEP CTSDEFFQAL 200
NHAEQTFKKM ENYLRHKQLC DVILVAGDRR IPAHRLVLSS VSDYFAAMFT 250
NDVREARQEE IKMEGVEPNS LWSLIQYAYT GRLELKEDNI ECLLSTACLL 300
QLSQVVEACC KFLMKQLHPS NCLGIRSFAD AQGCTDLHKV AHNYTMEHFM 350
EVIRNQEFVL LPASEIAKLL ASDDMNIPNE ETILNALLTW VRHDLEQRRK 400
DLSKLLAYIR LPLLAPQFLA DMENNVLFRD DIECQKLIME AMKYHLLPER 450
RPMLQSPRTK PRKSTVGTLF AVGGMDSTKG ATSIEKYDLR TNMWTPVANM 500
NGRRLQFGVA VLDDKLYVVG GRDGLKTLNT VECYNPKTKT WSVMPPMSTH 550
RHGLGVAVLE GPMYAVGGHD GWSYLNTVER WDPQARQWNF VATMSTPRST 600
VGVAVLSGKL YAVGGRDGSS CLKSVECFDP HTNKWTLCAQ MSKRRGGVGV 650
TTWNGLLYAI GGHDAPASNL TSRLSDCVER YDPKTDMWTA VASMSISRDA 700
VGVCLLGDKL YAVGGYDGQA YLNTVEAYDP QTNEWTQVAP LCLGRAGACV 750
VTVKL 755
Length:755
Mass (Da):84,457
Last modified:October 24, 2003 - v3
Checksum:i2AB1BFB98F387F6C
GO
Isoform 2 (identifier: Q96PQ7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     739-755: APLCLGRAGACVVTVKL → WHSCFIITLTLFLLKQFLW

Note: May be due to intron retention. No experimental confirmation available.

Show »
Length:757
Mass (Da):85,196
Checksum:i212A895F72E5A461
GO
Isoform 3 (identifier: Q96PQ7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     739-755: APLCLGRAGACVVTVKL → FSHTFEDSKDHLVAIKQTIWRQNSLSEEFRSH

Note: No experimental confirmation available.

Show »
Length:770
Mass (Da):86,660
Checksum:i14983625633AA991
GO
Isoform 4 (identifier: Q96PQ7-4) [UniParc]FASTAAdd to Basket

Also known as: KLHL5b

The sequence of this isoform differs from the canonical sequence as follows:
     174-234: Missing.

Note: Ubiquitous expression, differentially expressed in kidney and pancreas relatively to isoform 1.

Show »
Length:694
Mass (Da):77,452
Checksum:iAA3024889C329E09
GO
Isoform 5 (identifier: Q96PQ7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:568
Mass (Da):63,589
Checksum:i93A5D6C880E3534A
GO
Isoform 6 (identifier: Q96PQ7-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Show »
Length:709
Mass (Da):79,228
Checksum:i71C85C020A4CB92E
GO

Sequence cautioni

The sequence AAD32565.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91845.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91933.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA92121.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAL08584.1 differs from that shown. Reason: Erroneous termination at position 735. Translated as Trp.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti10 – 101I → L.4 Publications
Corresponds to variant rs2711941 [ dbSNP | Ensembl ].
VAR_050048
Natural varianti508 – 5081G → S.
Corresponds to variant rs34646863 [ dbSNP | Ensembl ].
VAR_033985

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 187187Missing in isoform 5. VSP_047111Add
BLAST
Alternative sequencei1 – 4646Missing in isoform 6. VSP_047112Add
BLAST
Alternative sequencei174 – 23461Missing in isoform 4. VSP_045227Add
BLAST
Alternative sequencei739 – 75517APLCL…VTVKL → WHSCFIITLTLFLLKQFLW in isoform 2. VSP_008619Add
BLAST
Alternative sequencei739 – 75517APLCL…VTVKL → FSHTFEDSKDHLVAIKQTIW RQNSLSEEFRSH in isoform 3. VSP_008620Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti129 – 1291P → S in AAO39710. 1 Publication
Sequence conflicti323 – 3231L → P in BAA91845. 1 Publication
Sequence conflicti351 – 3511E → G in AAO39710. 1 Publication
Sequence conflicti435 – 4351Q → R in AAL08584. 1 Publication
Sequence conflicti459 – 4591T → I in AAO39710. 1 Publication
Sequence conflicti594 – 5941M → K in BAA91845. 1 Publication
Sequence conflicti654 – 6541N → S in AAO39710. 1 Publication
Sequence conflicti695 – 6951S → G in BAA92121. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF272976 mRNA. Translation: AAL08584.1. Sequence problems.
AY172948 mRNA. Translation: AAO39710.1.
AK001698 mRNA. Translation: BAA91845.1. Different initiation.
AK001836 mRNA. Translation: BAA91933.1. Different initiation.
AK002174 mRNA. Translation: BAA92121.1. Different initiation.
AK289785 mRNA. Translation: BAF82474.1.
AC079921 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92908.1.
CH471069 Genomic DNA. Translation: EAW92911.1.
BC048262 mRNA. Translation: AAH48262.1.
AF123320 mRNA. Translation: AAD32565.1. Different initiation.
CCDSiCCDS33974.1. [Q96PQ7-1]
CCDS33975.1. [Q96PQ7-6]
CCDS3449.1. [Q96PQ7-4]
CCDS54756.1. [Q96PQ7-5]
RefSeqiNP_001007076.1. NM_001007075.2. [Q96PQ7-6]
NP_057074.3. NM_015990.4. [Q96PQ7-1]
NP_950240.2. NM_199039.3. [Q96PQ7-4]
UniGeneiHs.272251.

Genome annotation databases

EnsembliENST00000261425; ENSP00000261425; ENSG00000109790. [Q96PQ7-6]
ENST00000261426; ENSP00000261426; ENSG00000109790. [Q96PQ7-4]
ENST00000359687; ENSP00000352716; ENSG00000109790. [Q96PQ7-3]
ENST00000381930; ENSP00000371355; ENSG00000109790. [Q96PQ7-2]
ENST00000504108; ENSP00000423897; ENSG00000109790. [Q96PQ7-1]
ENST00000508137; ENSP00000423080; ENSG00000109790. [Q96PQ7-5]
GeneIDi51088.
KEGGihsa:51088.
UCSCiuc003gtp.3. human. [Q96PQ7-1]
uc003gtr.2. human. [Q96PQ7-2]

Polymorphism databases

DMDMi37999955.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF272976 mRNA. Translation: AAL08584.1 . Sequence problems.
AY172948 mRNA. Translation: AAO39710.1 .
AK001698 mRNA. Translation: BAA91845.1 . Different initiation.
AK001836 mRNA. Translation: BAA91933.1 . Different initiation.
AK002174 mRNA. Translation: BAA92121.1 . Different initiation.
AK289785 mRNA. Translation: BAF82474.1 .
AC079921 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92908.1 .
CH471069 Genomic DNA. Translation: EAW92911.1 .
BC048262 mRNA. Translation: AAH48262.1 .
AF123320 mRNA. Translation: AAD32565.1 . Different initiation.
CCDSi CCDS33974.1. [Q96PQ7-1 ]
CCDS33975.1. [Q96PQ7-6 ]
CCDS3449.1. [Q96PQ7-4 ]
CCDS54756.1. [Q96PQ7-5 ]
RefSeqi NP_001007076.1. NM_001007075.2. [Q96PQ7-6 ]
NP_057074.3. NM_015990.4. [Q96PQ7-1 ]
NP_950240.2. NM_199039.3. [Q96PQ7-4 ]
UniGenei Hs.272251.

3D structure databases

ProteinModelPortali Q96PQ7.
SMRi Q96PQ7. Positions 195-447, 467-753.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119278. 7 interactions.
IntActi Q96PQ7. 12 interactions.
MINTi MINT-6780713.
STRINGi 9606.ENSP00000371358.

PTM databases

PhosphoSitei Q96PQ7.

Polymorphism databases

DMDMi 37999955.

Proteomic databases

MaxQBi Q96PQ7.
PaxDbi Q96PQ7.
PRIDEi Q96PQ7.

Protocols and materials databases

DNASUi 51088.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261425 ; ENSP00000261425 ; ENSG00000109790 . [Q96PQ7-6 ]
ENST00000261426 ; ENSP00000261426 ; ENSG00000109790 . [Q96PQ7-4 ]
ENST00000359687 ; ENSP00000352716 ; ENSG00000109790 . [Q96PQ7-3 ]
ENST00000381930 ; ENSP00000371355 ; ENSG00000109790 . [Q96PQ7-2 ]
ENST00000504108 ; ENSP00000423897 ; ENSG00000109790 . [Q96PQ7-1 ]
ENST00000508137 ; ENSP00000423080 ; ENSG00000109790 . [Q96PQ7-5 ]
GeneIDi 51088.
KEGGi hsa:51088.
UCSCi uc003gtp.3. human. [Q96PQ7-1 ]
uc003gtr.2. human. [Q96PQ7-2 ]

Organism-specific databases

CTDi 51088.
GeneCardsi GC04P038961.
HGNCi HGNC:6356. KLHL5.
HPAi HPA013958.
MIMi 608064. gene.
neXtProti NX_Q96PQ7.
PharmGKBi PA30146.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG280486.
HOVERGENi HBG014286.
KOi K10442.
OMAi CTSDEFF.
OrthoDBi EOG7ZWD17.
PhylomeDBi Q96PQ7.
TreeFami TF329218.

Miscellaneous databases

GenomeRNAii 51088.
NextBioi 53759.
PROi Q96PQ7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96PQ7.
Bgeei Q96PQ7.
CleanExi HS_KLHL5.
Genevestigatori Q96PQ7.

Family and domain databases

Gene3Di 2.130.10.80. 1 hit.
3.30.710.10. 1 hit.
InterProi IPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
[Graphical view ]
Pfami PF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view ]
SMARTi SM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view ]
SUPFAMi SSF54695. SSF54695. 1 hit.
PROSITEi PS50097. BTB. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of KLHL5, a novel human gene encoding a kelch-related protein with a BTB domain."
    Wang S., Zhou Z., Ying K., Tang R., Huang Y., Wu C., Xie Y., Mao Y.
    Biochem. Genet. 39:227-238(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 2), VARIANT LEU-10.
    Tissue: Fetal brain.
  2. "Characterization of a novel splicing variant of KLHL5, a member of the kelch protein family."
    Xu J., Gu S., Wang S., Dai J., Ji C., Jin Y., Qian J., Wang L., Ye X., Xie Y., Mao Y.
    Mol. Biol. Rep. 30:239-242(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT LEU-10, ALTERNATIVE SPLICING.
    Tissue: Fetal brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 476-755 (ISOFORM 2), VARIANT LEU-10.
    Tissue: Brain and Placenta.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LEU-10.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 383-755 (ISOFORM 1).
    Tissue: Uterus.
  7. Jiyi Y., Lianxian C., Zhengjian Z., Bo Y.
    Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 490-755 (ISOFORM 3).
    Tissue: Tonsil.

Entry informationi

Entry nameiKLHL5_HUMAN
AccessioniPrimary (citable) accession number: Q96PQ7
Secondary accession number(s): A8K170
, B7WP68, E9PCF4, F8WAE7, G3XA92, Q6Y881, Q86XW0, Q9NUK3, Q9NV27, Q9NVA9, Q9Y2X2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: October 24, 2003
Last modified: July 9, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi