Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 5

Gene

KLHL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Actin-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000109790-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 5
Gene namesi
Name:KLHL5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:6356. KLHL5.

Subcellular locationi

GO - Cellular componenti

  • Cul3-RING ubiquitin ligase complex Source: GO_Central
  • cytoplasm Source: UniProtKB
  • cytoskeleton Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

DisGeNETi51088.
OpenTargetsiENSG00000109790.
PharmGKBiPA30146.

Polymorphism and mutation databases

BioMutaiKLHL5.
DMDMi37999955.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001191051 – 755Kelch-like protein 5Add BLAST755

Proteomic databases

MaxQBiQ96PQ7.
PaxDbiQ96PQ7.
PeptideAtlasiQ96PQ7.
PRIDEiQ96PQ7.

PTM databases

iPTMnetiQ96PQ7.
PhosphoSitePlusiQ96PQ7.

Expressioni

Tissue specificityi

Expressed in adrenal gland, ovary and thyroid gland and less abundantly in lymph node, prostate, spinal chord, testis and trachea.

Gene expression databases

BgeeiENSG00000109790.
CleanExiHS_KLHL5.
ExpressionAtlasiQ96PQ7. baseline and differential.
GenevisibleiQ96PQ7. HS.

Organism-specific databases

HPAiHPA013958.

Interactioni

Protein-protein interaction databases

BioGridi119278. 6 interactors.
IntActiQ96PQ7. 12 interactors.
MINTiMINT-6780713.
STRINGi9606.ENSP00000423897.

Structurei

3D structure databases

ProteinModelPortaliQ96PQ7.
SMRiQ96PQ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini220 – 287BTBPROSITE-ProRule annotationAdd BLAST68
Repeati468 – 514Kelch 1Add BLAST47
Repeati515 – 561Kelch 2Add BLAST47
Repeati563 – 608Kelch 3Add BLAST46
Repeati609 – 655Kelch 4Add BLAST47
Repeati657 – 708Kelch 5Add BLAST52
Repeati709 – 754Kelch 6Add BLAST46

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 6 Kelch repeats.Curated

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118931.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ96PQ7.
KOiK10442.
OMAiCTSDEFF.
OrthoDBiEOG091G04QJ.
PhylomeDBiQ96PQ7.
TreeFamiTF329218.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR030606. KLHL5.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF135. PTHR24412:SF135. 1 hit.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96PQ7-1) [UniParc]FASTAAdd to basket
Also known as: KLHL5a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNVIYFPLHI FVVYSRAYTS LVLVGCTNLC AVLFARCLDD HLVSLRMSGS
60 70 80 90 100
RKEFDVKQIL KIRWRWFGHQ ASSPNSTVDS QQGEFWNRGQ TGANGGRKFL
110 120 130 140 150
DPCSLQLPLA SIGYRRSSQL DFQNSPSWPM ASTSEVPAFE FTAEDCGGAH
160 170 180 190 200
WLDRPEVDDG TSEEENESDS SSCRTSNSSQ TLSSCHTMEP CTSDEFFQAL
210 220 230 240 250
NHAEQTFKKM ENYLRHKQLC DVILVAGDRR IPAHRLVLSS VSDYFAAMFT
260 270 280 290 300
NDVREARQEE IKMEGVEPNS LWSLIQYAYT GRLELKEDNI ECLLSTACLL
310 320 330 340 350
QLSQVVEACC KFLMKQLHPS NCLGIRSFAD AQGCTDLHKV AHNYTMEHFM
360 370 380 390 400
EVIRNQEFVL LPASEIAKLL ASDDMNIPNE ETILNALLTW VRHDLEQRRK
410 420 430 440 450
DLSKLLAYIR LPLLAPQFLA DMENNVLFRD DIECQKLIME AMKYHLLPER
460 470 480 490 500
RPMLQSPRTK PRKSTVGTLF AVGGMDSTKG ATSIEKYDLR TNMWTPVANM
510 520 530 540 550
NGRRLQFGVA VLDDKLYVVG GRDGLKTLNT VECYNPKTKT WSVMPPMSTH
560 570 580 590 600
RHGLGVAVLE GPMYAVGGHD GWSYLNTVER WDPQARQWNF VATMSTPRST
610 620 630 640 650
VGVAVLSGKL YAVGGRDGSS CLKSVECFDP HTNKWTLCAQ MSKRRGGVGV
660 670 680 690 700
TTWNGLLYAI GGHDAPASNL TSRLSDCVER YDPKTDMWTA VASMSISRDA
710 720 730 740 750
VGVCLLGDKL YAVGGYDGQA YLNTVEAYDP QTNEWTQVAP LCLGRAGACV

VTVKL
Length:755
Mass (Da):84,457
Last modified:October 24, 2003 - v3
Checksum:i2AB1BFB98F387F6C
GO
Isoform 2 (identifier: Q96PQ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     739-755: APLCLGRAGACVVTVKL → WHSCFIITLTLFLLKQFLW

Note: May be due to intron retention. No experimental confirmation available.
Show »
Length:757
Mass (Da):85,196
Checksum:i212A895F72E5A461
GO
Isoform 3 (identifier: Q96PQ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     739-755: APLCLGRAGACVVTVKL → FSHTFEDSKDHLVAIKQTIWRQNSLSEEFRSH

Note: No experimental confirmation available.
Show »
Length:770
Mass (Da):86,660
Checksum:i14983625633AA991
GO
Isoform 4 (identifier: Q96PQ7-4) [UniParc]FASTAAdd to basket
Also known as: KLHL5b

The sequence of this isoform differs from the canonical sequence as follows:
     174-234: Missing.

Note: Ubiquitous expression, differentially expressed in kidney and pancreas relatively to isoform 1.
Show »
Length:694
Mass (Da):77,452
Checksum:iAA3024889C329E09
GO
Isoform 5 (identifier: Q96PQ7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-187: Missing.

Show »
Length:568
Mass (Da):63,589
Checksum:i93A5D6C880E3534A
GO
Isoform 6 (identifier: Q96PQ7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Show »
Length:709
Mass (Da):79,228
Checksum:i71C85C020A4CB92E
GO

Sequence cautioni

The sequence AAD32565 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAL08584 differs from that shown. Reason: Erroneous termination at position 735. Translated as Trp.Curated
The sequence BAA91845 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91933 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA92121 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti129P → S in AAO39710 (PubMed:14672410).Curated1
Sequence conflicti323L → P in BAA91845 (PubMed:14702039).Curated1
Sequence conflicti351E → G in AAO39710 (PubMed:14672410).Curated1
Sequence conflicti435Q → R in AAL08584 (PubMed:11590829).Curated1
Sequence conflicti459T → I in AAO39710 (PubMed:14672410).Curated1
Sequence conflicti594M → K in BAA91845 (PubMed:14702039).Curated1
Sequence conflicti654N → S in AAO39710 (PubMed:14672410).Curated1
Sequence conflicti695S → G in BAA92121 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05004810I → L.4 PublicationsCorresponds to variant rs2711941dbSNPEnsembl.1
Natural variantiVAR_033985508G → S.Corresponds to variant rs34646863dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471111 – 187Missing in isoform 5. CuratedAdd BLAST187
Alternative sequenceiVSP_0471121 – 46Missing in isoform 6. CuratedAdd BLAST46
Alternative sequenceiVSP_045227174 – 234Missing in isoform 4. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_008619739 – 755APLCL…VTVKL → WHSCFIITLTLFLLKQFLW in isoform 2. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_008620739 – 755APLCL…VTVKL → FSHTFEDSKDHLVAIKQTIW RQNSLSEEFRSH in isoform 3. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF272976 mRNA. Translation: AAL08584.1. Sequence problems.
AY172948 mRNA. Translation: AAO39710.1.
AK001698 mRNA. Translation: BAA91845.1. Different initiation.
AK001836 mRNA. Translation: BAA91933.1. Different initiation.
AK002174 mRNA. Translation: BAA92121.1. Different initiation.
AK289785 mRNA. Translation: BAF82474.1.
AC079921 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92908.1.
CH471069 Genomic DNA. Translation: EAW92911.1.
BC048262 mRNA. Translation: AAH48262.1.
AF123320 mRNA. Translation: AAD32565.1. Different initiation.
CCDSiCCDS33974.1. [Q96PQ7-1]
CCDS33975.1. [Q96PQ7-6]
CCDS3449.1. [Q96PQ7-4]
CCDS54756.1. [Q96PQ7-5]
RefSeqiNP_001007076.1. NM_001007075.2. [Q96PQ7-6]
NP_057074.3. NM_015990.4. [Q96PQ7-1]
NP_950240.2. NM_199039.3. [Q96PQ7-4]
UniGeneiHs.272251.

Genome annotation databases

EnsembliENST00000261425; ENSP00000261425; ENSG00000109790. [Q96PQ7-6]
ENST00000261426; ENSP00000261426; ENSG00000109790. [Q96PQ7-4]
ENST00000381930; ENSP00000371355; ENSG00000109790. [Q96PQ7-2]
ENST00000504108; ENSP00000423897; ENSG00000109790. [Q96PQ7-1]
ENST00000508137; ENSP00000423080; ENSG00000109790. [Q96PQ7-5]
GeneIDi51088.
KEGGihsa:51088.
UCSCiuc003gtp.4. human. [Q96PQ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF272976 mRNA. Translation: AAL08584.1. Sequence problems.
AY172948 mRNA. Translation: AAO39710.1.
AK001698 mRNA. Translation: BAA91845.1. Different initiation.
AK001836 mRNA. Translation: BAA91933.1. Different initiation.
AK002174 mRNA. Translation: BAA92121.1. Different initiation.
AK289785 mRNA. Translation: BAF82474.1.
AC079921 Genomic DNA. No translation available.
CH471069 Genomic DNA. Translation: EAW92908.1.
CH471069 Genomic DNA. Translation: EAW92911.1.
BC048262 mRNA. Translation: AAH48262.1.
AF123320 mRNA. Translation: AAD32565.1. Different initiation.
CCDSiCCDS33974.1. [Q96PQ7-1]
CCDS33975.1. [Q96PQ7-6]
CCDS3449.1. [Q96PQ7-4]
CCDS54756.1. [Q96PQ7-5]
RefSeqiNP_001007076.1. NM_001007075.2. [Q96PQ7-6]
NP_057074.3. NM_015990.4. [Q96PQ7-1]
NP_950240.2. NM_199039.3. [Q96PQ7-4]
UniGeneiHs.272251.

3D structure databases

ProteinModelPortaliQ96PQ7.
SMRiQ96PQ7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119278. 6 interactors.
IntActiQ96PQ7. 12 interactors.
MINTiMINT-6780713.
STRINGi9606.ENSP00000423897.

PTM databases

iPTMnetiQ96PQ7.
PhosphoSitePlusiQ96PQ7.

Polymorphism and mutation databases

BioMutaiKLHL5.
DMDMi37999955.

Proteomic databases

MaxQBiQ96PQ7.
PaxDbiQ96PQ7.
PeptideAtlasiQ96PQ7.
PRIDEiQ96PQ7.

Protocols and materials databases

DNASUi51088.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261425; ENSP00000261425; ENSG00000109790. [Q96PQ7-6]
ENST00000261426; ENSP00000261426; ENSG00000109790. [Q96PQ7-4]
ENST00000381930; ENSP00000371355; ENSG00000109790. [Q96PQ7-2]
ENST00000504108; ENSP00000423897; ENSG00000109790. [Q96PQ7-1]
ENST00000508137; ENSP00000423080; ENSG00000109790. [Q96PQ7-5]
GeneIDi51088.
KEGGihsa:51088.
UCSCiuc003gtp.4. human. [Q96PQ7-1]

Organism-specific databases

CTDi51088.
DisGeNETi51088.
GeneCardsiKLHL5.
HGNCiHGNC:6356. KLHL5.
HPAiHPA013958.
MIMi608064. gene.
neXtProtiNX_Q96PQ7.
OpenTargetsiENSG00000109790.
PharmGKBiPA30146.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118931.
HOGENOMiHOG000230814.
HOVERGENiHBG014286.
InParanoidiQ96PQ7.
KOiK10442.
OMAiCTSDEFF.
OrthoDBiEOG091G04QJ.
PhylomeDBiQ96PQ7.
TreeFamiTF329218.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000109790-MONOMER.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

GenomeRNAii51088.
PROiQ96PQ7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109790.
CleanExiHS_KLHL5.
ExpressionAtlasiQ96PQ7. baseline and differential.
GenevisibleiQ96PQ7. HS.

Family and domain databases

Gene3Di2.130.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ_dom.
IPR015916. Gal_Oxidase_b-propeller.
IPR006652. Kelch_1.
IPR030606. KLHL5.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF135. PTHR24412:SF135. 1 hit.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 6 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 1 hit.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLHL5_HUMAN
AccessioniPrimary (citable) accession number: Q96PQ7
Secondary accession number(s): A8K170
, B7WP68, E9PCF4, F8WAE7, G3XA92, Q6Y881, Q86XW0, Q9NUK3, Q9NV27, Q9NVA9, Q9Y2X2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: October 24, 2003
Last modified: November 2, 2016
This is version 134 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.