Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96PQ7

- KLHL5_HUMAN

UniProt

Q96PQ7 - KLHL5_HUMAN

Protein

Kelch-like protein 5

Gene

KLHL5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 3 (24 Oct 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Keywords - Ligandi

    Actin-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kelch-like protein 5
    Gene namesi
    Name:KLHL5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:6356. KLHL5.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. cytoskeleton Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30146.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 755755Kelch-like protein 5PRO_0000119105Add
    BLAST

    Proteomic databases

    MaxQBiQ96PQ7.
    PaxDbiQ96PQ7.
    PRIDEiQ96PQ7.

    PTM databases

    PhosphoSiteiQ96PQ7.

    Expressioni

    Tissue specificityi

    Expressed in adrenal gland, ovary and thyroid gland and less abundantly in lymph node, prostate, spinal chord, testis and trachea.

    Gene expression databases

    ArrayExpressiQ96PQ7.
    BgeeiQ96PQ7.
    CleanExiHS_KLHL5.
    GenevestigatoriQ96PQ7.

    Organism-specific databases

    HPAiHPA013958.

    Interactioni

    Protein-protein interaction databases

    BioGridi119278. 7 interactions.
    IntActiQ96PQ7. 12 interactions.
    MINTiMINT-6780713.
    STRINGi9606.ENSP00000371358.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96PQ7.
    SMRiQ96PQ7. Positions 195-447, 467-753.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini220 – 28768BTBPROSITE-ProRule annotationAdd
    BLAST
    Repeati468 – 51447Kelch 1Add
    BLAST
    Repeati515 – 56147Kelch 2Add
    BLAST
    Repeati563 – 60846Kelch 3Add
    BLAST
    Repeati609 – 65547Kelch 4Add
    BLAST
    Repeati657 – 70852Kelch 5Add
    BLAST
    Repeati709 – 75446Kelch 6Add
    BLAST

    Sequence similaritiesi

    Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
    Contains 6 Kelch repeats.Curated

    Keywords - Domaini

    Kelch repeat, Repeat

    Phylogenomic databases

    eggNOGiNOG280486.
    HOVERGENiHBG014286.
    KOiK10442.
    OMAiCTSDEFF.
    OrthoDBiEOG7ZWD17.
    PhylomeDBiQ96PQ7.
    TreeFamiTF329218.

    Family and domain databases

    Gene3Di2.130.10.80. 1 hit.
    3.30.710.10. 1 hit.
    InterProiIPR011705. BACK.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR015916. Gal_Oxidase_b-propeller.
    IPR006652. Kelch_1.
    [Graphical view]
    PfamiPF07707. BACK. 1 hit.
    PF00651. BTB. 1 hit.
    PF01344. Kelch_1. 6 hits.
    [Graphical view]
    SMARTiSM00875. BACK. 1 hit.
    SM00225. BTB. 1 hit.
    SM00612. Kelch. 6 hits.
    [Graphical view]
    SUPFAMiSSF54695. SSF54695. 1 hit.
    PROSITEiPS50097. BTB. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96PQ7-1) [UniParc]FASTAAdd to Basket

    Also known as: KLHL5a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNVIYFPLHI FVVYSRAYTS LVLVGCTNLC AVLFARCLDD HLVSLRMSGS    50
    RKEFDVKQIL KIRWRWFGHQ ASSPNSTVDS QQGEFWNRGQ TGANGGRKFL 100
    DPCSLQLPLA SIGYRRSSQL DFQNSPSWPM ASTSEVPAFE FTAEDCGGAH 150
    WLDRPEVDDG TSEEENESDS SSCRTSNSSQ TLSSCHTMEP CTSDEFFQAL 200
    NHAEQTFKKM ENYLRHKQLC DVILVAGDRR IPAHRLVLSS VSDYFAAMFT 250
    NDVREARQEE IKMEGVEPNS LWSLIQYAYT GRLELKEDNI ECLLSTACLL 300
    QLSQVVEACC KFLMKQLHPS NCLGIRSFAD AQGCTDLHKV AHNYTMEHFM 350
    EVIRNQEFVL LPASEIAKLL ASDDMNIPNE ETILNALLTW VRHDLEQRRK 400
    DLSKLLAYIR LPLLAPQFLA DMENNVLFRD DIECQKLIME AMKYHLLPER 450
    RPMLQSPRTK PRKSTVGTLF AVGGMDSTKG ATSIEKYDLR TNMWTPVANM 500
    NGRRLQFGVA VLDDKLYVVG GRDGLKTLNT VECYNPKTKT WSVMPPMSTH 550
    RHGLGVAVLE GPMYAVGGHD GWSYLNTVER WDPQARQWNF VATMSTPRST 600
    VGVAVLSGKL YAVGGRDGSS CLKSVECFDP HTNKWTLCAQ MSKRRGGVGV 650
    TTWNGLLYAI GGHDAPASNL TSRLSDCVER YDPKTDMWTA VASMSISRDA 700
    VGVCLLGDKL YAVGGYDGQA YLNTVEAYDP QTNEWTQVAP LCLGRAGACV 750
    VTVKL 755
    Length:755
    Mass (Da):84,457
    Last modified:October 24, 2003 - v3
    Checksum:i2AB1BFB98F387F6C
    GO
    Isoform 2 (identifier: Q96PQ7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         739-755: APLCLGRAGACVVTVKL → WHSCFIITLTLFLLKQFLW

    Note: May be due to intron retention. No experimental confirmation available.

    Show »
    Length:757
    Mass (Da):85,196
    Checksum:i212A895F72E5A461
    GO
    Isoform 3 (identifier: Q96PQ7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         739-755: APLCLGRAGACVVTVKL → FSHTFEDSKDHLVAIKQTIWRQNSLSEEFRSH

    Note: No experimental confirmation available.

    Show »
    Length:770
    Mass (Da):86,660
    Checksum:i14983625633AA991
    GO
    Isoform 4 (identifier: Q96PQ7-4) [UniParc]FASTAAdd to Basket

    Also known as: KLHL5b

    The sequence of this isoform differs from the canonical sequence as follows:
         174-234: Missing.

    Note: Ubiquitous expression, differentially expressed in kidney and pancreas relatively to isoform 1.

    Show »
    Length:694
    Mass (Da):77,452
    Checksum:iAA3024889C329E09
    GO
    Isoform 5 (identifier: Q96PQ7-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-187: Missing.

    Show »
    Length:568
    Mass (Da):63,589
    Checksum:i93A5D6C880E3534A
    GO
    Isoform 6 (identifier: Q96PQ7-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: Missing.

    Show »
    Length:709
    Mass (Da):79,228
    Checksum:i71C85C020A4CB92E
    GO

    Sequence cautioni

    The sequence AAD32565.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA91845.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA91933.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA92121.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAL08584.1 differs from that shown. Reason: Erroneous termination at position 735. Translated as Trp.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti129 – 1291P → S in AAO39710. (PubMed:14672410)Curated
    Sequence conflicti323 – 3231L → P in BAA91845. (PubMed:14702039)Curated
    Sequence conflicti351 – 3511E → G in AAO39710. (PubMed:14672410)Curated
    Sequence conflicti435 – 4351Q → R in AAL08584. (PubMed:11590829)Curated
    Sequence conflicti459 – 4591T → I in AAO39710. (PubMed:14672410)Curated
    Sequence conflicti594 – 5941M → K in BAA91845. (PubMed:14702039)Curated
    Sequence conflicti654 – 6541N → S in AAO39710. (PubMed:14672410)Curated
    Sequence conflicti695 – 6951S → G in BAA92121. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti10 – 101I → L.4 Publications
    Corresponds to variant rs2711941 [ dbSNP | Ensembl ].
    VAR_050048
    Natural varianti508 – 5081G → S.
    Corresponds to variant rs34646863 [ dbSNP | Ensembl ].
    VAR_033985

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 187187Missing in isoform 5. CuratedVSP_047111Add
    BLAST
    Alternative sequencei1 – 4646Missing in isoform 6. CuratedVSP_047112Add
    BLAST
    Alternative sequencei174 – 23461Missing in isoform 4. 1 PublicationVSP_045227Add
    BLAST
    Alternative sequencei739 – 75517APLCL…VTVKL → WHSCFIITLTLFLLKQFLW in isoform 2. 1 PublicationVSP_008619Add
    BLAST
    Alternative sequencei739 – 75517APLCL…VTVKL → FSHTFEDSKDHLVAIKQTIW RQNSLSEEFRSH in isoform 3. 1 PublicationVSP_008620Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF272976 mRNA. Translation: AAL08584.1. Sequence problems.
    AY172948 mRNA. Translation: AAO39710.1.
    AK001698 mRNA. Translation: BAA91845.1. Different initiation.
    AK001836 mRNA. Translation: BAA91933.1. Different initiation.
    AK002174 mRNA. Translation: BAA92121.1. Different initiation.
    AK289785 mRNA. Translation: BAF82474.1.
    AC079921 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92908.1.
    CH471069 Genomic DNA. Translation: EAW92911.1.
    BC048262 mRNA. Translation: AAH48262.1.
    AF123320 mRNA. Translation: AAD32565.1. Different initiation.
    CCDSiCCDS33974.1. [Q96PQ7-1]
    CCDS33975.1. [Q96PQ7-6]
    CCDS3449.1. [Q96PQ7-4]
    CCDS54756.1. [Q96PQ7-5]
    RefSeqiNP_001007076.1. NM_001007075.2. [Q96PQ7-6]
    NP_057074.3. NM_015990.4. [Q96PQ7-1]
    NP_950240.2. NM_199039.3. [Q96PQ7-4]
    UniGeneiHs.272251.

    Genome annotation databases

    EnsembliENST00000261425; ENSP00000261425; ENSG00000109790. [Q96PQ7-6]
    ENST00000261426; ENSP00000261426; ENSG00000109790. [Q96PQ7-4]
    ENST00000381930; ENSP00000371355; ENSG00000109790. [Q96PQ7-2]
    ENST00000504108; ENSP00000423897; ENSG00000109790. [Q96PQ7-1]
    ENST00000508137; ENSP00000423080; ENSG00000109790. [Q96PQ7-5]
    GeneIDi51088.
    KEGGihsa:51088.
    UCSCiuc003gtp.3. human. [Q96PQ7-1]
    uc003gtr.2. human. [Q96PQ7-2]

    Polymorphism databases

    DMDMi37999955.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF272976 mRNA. Translation: AAL08584.1 . Sequence problems.
    AY172948 mRNA. Translation: AAO39710.1 .
    AK001698 mRNA. Translation: BAA91845.1 . Different initiation.
    AK001836 mRNA. Translation: BAA91933.1 . Different initiation.
    AK002174 mRNA. Translation: BAA92121.1 . Different initiation.
    AK289785 mRNA. Translation: BAF82474.1 .
    AC079921 Genomic DNA. No translation available.
    CH471069 Genomic DNA. Translation: EAW92908.1 .
    CH471069 Genomic DNA. Translation: EAW92911.1 .
    BC048262 mRNA. Translation: AAH48262.1 .
    AF123320 mRNA. Translation: AAD32565.1 . Different initiation.
    CCDSi CCDS33974.1. [Q96PQ7-1 ]
    CCDS33975.1. [Q96PQ7-6 ]
    CCDS3449.1. [Q96PQ7-4 ]
    CCDS54756.1. [Q96PQ7-5 ]
    RefSeqi NP_001007076.1. NM_001007075.2. [Q96PQ7-6 ]
    NP_057074.3. NM_015990.4. [Q96PQ7-1 ]
    NP_950240.2. NM_199039.3. [Q96PQ7-4 ]
    UniGenei Hs.272251.

    3D structure databases

    ProteinModelPortali Q96PQ7.
    SMRi Q96PQ7. Positions 195-447, 467-753.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119278. 7 interactions.
    IntActi Q96PQ7. 12 interactions.
    MINTi MINT-6780713.
    STRINGi 9606.ENSP00000371358.

    PTM databases

    PhosphoSitei Q96PQ7.

    Polymorphism databases

    DMDMi 37999955.

    Proteomic databases

    MaxQBi Q96PQ7.
    PaxDbi Q96PQ7.
    PRIDEi Q96PQ7.

    Protocols and materials databases

    DNASUi 51088.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261425 ; ENSP00000261425 ; ENSG00000109790 . [Q96PQ7-6 ]
    ENST00000261426 ; ENSP00000261426 ; ENSG00000109790 . [Q96PQ7-4 ]
    ENST00000381930 ; ENSP00000371355 ; ENSG00000109790 . [Q96PQ7-2 ]
    ENST00000504108 ; ENSP00000423897 ; ENSG00000109790 . [Q96PQ7-1 ]
    ENST00000508137 ; ENSP00000423080 ; ENSG00000109790 . [Q96PQ7-5 ]
    GeneIDi 51088.
    KEGGi hsa:51088.
    UCSCi uc003gtp.3. human. [Q96PQ7-1 ]
    uc003gtr.2. human. [Q96PQ7-2 ]

    Organism-specific databases

    CTDi 51088.
    GeneCardsi GC04P038961.
    HGNCi HGNC:6356. KLHL5.
    HPAi HPA013958.
    MIMi 608064. gene.
    neXtProti NX_Q96PQ7.
    PharmGKBi PA30146.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG280486.
    HOVERGENi HBG014286.
    KOi K10442.
    OMAi CTSDEFF.
    OrthoDBi EOG7ZWD17.
    PhylomeDBi Q96PQ7.
    TreeFami TF329218.

    Miscellaneous databases

    GenomeRNAii 51088.
    NextBioi 53759.
    PROi Q96PQ7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96PQ7.
    Bgeei Q96PQ7.
    CleanExi HS_KLHL5.
    Genevestigatori Q96PQ7.

    Family and domain databases

    Gene3Di 2.130.10.80. 1 hit.
    3.30.710.10. 1 hit.
    InterProi IPR011705. BACK.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR015916. Gal_Oxidase_b-propeller.
    IPR006652. Kelch_1.
    [Graphical view ]
    Pfami PF07707. BACK. 1 hit.
    PF00651. BTB. 1 hit.
    PF01344. Kelch_1. 6 hits.
    [Graphical view ]
    SMARTi SM00875. BACK. 1 hit.
    SM00225. BTB. 1 hit.
    SM00612. Kelch. 6 hits.
    [Graphical view ]
    SUPFAMi SSF54695. SSF54695. 1 hit.
    PROSITEi PS50097. BTB. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of KLHL5, a novel human gene encoding a kelch-related protein with a BTB domain."
      Wang S., Zhou Z., Ying K., Tang R., Huang Y., Wu C., Xie Y., Mao Y.
      Biochem. Genet. 39:227-238(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORMS 1 AND 2), VARIANT LEU-10.
      Tissue: Fetal brain.
    2. "Characterization of a novel splicing variant of KLHL5, a member of the kelch protein family."
      Xu J., Gu S., Wang S., Dai J., Ji C., Jin Y., Qian J., Wang L., Ye X., Xie Y., Mao Y.
      Mol. Biol. Rep. 30:239-242(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT LEU-10, ALTERNATIVE SPLICING.
      Tissue: Fetal brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 476-755 (ISOFORM 2), VARIANT LEU-10.
      Tissue: Brain and Placenta.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LEU-10.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 383-755 (ISOFORM 1).
      Tissue: Uterus.
    7. Jiyi Y., Lianxian C., Zhengjian Z., Bo Y.
      Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 490-755 (ISOFORM 3).
      Tissue: Tonsil.

    Entry informationi

    Entry nameiKLHL5_HUMAN
    AccessioniPrimary (citable) accession number: Q96PQ7
    Secondary accession number(s): A8K170
    , B7WP68, E9PCF4, F8WAE7, G3XA92, Q6Y881, Q86XW0, Q9NUK3, Q9NV27, Q9NVA9, Q9Y2X2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 27, 2002
    Last sequence update: October 24, 2003
    Last modified: October 1, 2014
    This is version 116 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3