Q96PE3 (INP4A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Type I inositol 3,4-bisphosphate 4-phosphatase EC=3.1.3.66 Alternative name(s): Inositol polyphosphate 4-phosphatase type I | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 977 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate. |
| Catalytic activity | 1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate. |
| Pathway | Signal transduction; phosphatidylinositol signaling pathway. |
| Tissue specificity | Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain. Ref.3 |
| Sequence similarities | Belongs to the inositol 3,4-bisphosphate 4-phosphatase family. Contains 1 C2 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Hydrolase |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phosphatidylinositol-3-phosphate biosynthetic process Inferred from electronic annotation. Source: GOC signal transductionTraceable author statement Ref.1. Source: ProtInc small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity Inferred from electronic annotation. Source: EC phosphatidylinositol-4,5-bisphosphate 4-phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96PE3-1) Also known as: Alpha-3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96PE3-2) Also known as: Alpha-1; The sequence of this isoform differs from the canonical sequence as follows: 574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D | ||||||
| Isoform 3 (identifier: Q96PE3-3) The sequence of this isoform differs from the canonical sequence as follows: 389-393: Missing. | ||||||
| Isoform 4 (identifier: Q96PE3-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D 935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK | ||||||
| Note: Inactive. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 977 | 977 | Type I inositol 3,4-bisphosphate 4-phosphatase | PRO_0000190232 | |||||
Regions | |||||||||
| Domain | 31 – 137 | 107 | C2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 355 | 1 | Phosphotyrosine Ref.6 | ||||||
| Modified residue | 487 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 389 – 393 | 5 | Missing in isoform 3. | VSP_015240 | |||||
| Alternative sequence | 574 – 613 | 40 | GNPDS…HLTTH → D in isoform 2 and isoform 4. | VSP_015241 | |||||
| Alternative sequence | 935 – 977 | 43 | EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4. | VSP_015242 | |||||
| Natural variant | 604 | 1 | T → A. Corresponds to variant rs2278206 [ dbSNP | Ensembl ]. | VAR_059359 | |||||
Experimental info | |||||||||
| Sequence conflict | 767 | 1 | G → E in AAH28361. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase." Norris F.A., Auethavekiat V., Majerus P.W. J. Biol. Chem. 270:16128-16133(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family." Norris F.A., Atkins R.C., Majerus P.W. J. Biol. Chem. 272:23859-23864(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Brain. |
| [3] | "Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene." Shearn C.T., Walker J., Norris F.A. Biochem. Biophys. Res. Commun. 286:119-125(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Testis. |
| [6] | "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J. Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-355, MASS SPECTROMETRY. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-487, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | U26398 mRNA. Translation: AAB01068.1. U96919 mRNA. Translation: AAB72150.1. AF368319 mRNA. Translation: AAK58870.1. AC010134 Genomic DNA. Translation: AAX93230.1. BC028361 mRNA. Translation: AAH28361.1. |
| IPI | IPI00044388. IPI00215830. IPI00645392. IPI00916254. |
| PIR | B57487. |
| RefSeq | NP_001127696.1. NM_001134224.1. NP_001127697.1. NM_001134225.1. NP_001557.1. NM_001566.2. NP_004018.1. NM_004027.2. |
| UniGene | Hs.469386. |
3D structure databases | |
| ProteinModelPortal | Q96PE3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1188108. |
| STRING | 9606.ENSP00000074304. |
PTM databases | |
| PhosphoSite | Q96PE3. |
Polymorphism databases | |
| DMDM | 73920059. |
Proteomic databases | |
| PaxDb | Q96PE3. |
| PRIDE | Q96PE3. |
Protocols and materials databases | |
| DNASU | 3631. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000074304; ENSP00000074304; ENSG00000040933. ENST00000409016; ENSP00000386704; ENSG00000040933. ENST00000409540; ENSP00000387294; ENSG00000040933. ENST00000409851; ENSP00000386777; ENSG00000040933. ENST00000523221; ENSP00000427722; ENSG00000040933. |
| GeneID | 3631. |
| KEGG | hsa:3631. |
| UCSC | uc002syx.3. human. uc002syy.3. human. uc010yvj.1. human. uc010yvk.2. human. |
Organism-specific databases | |
| CTD | 3631. |
| GeneCards | GC02P099061. |
| HGNC | HGNC:6074. INPP4A. |
| HPA | HPA001628. |
| MIM | 600916. gene. |
| neXtProt | NX_Q96PE3. |
| PharmGKB | PA29882. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG289097. |
| HOGENOM | HOG000113075. |
| HOVERGEN | HBG081796. |
| InParanoid | Q96PE3. |
| KO | K01109. |
| OMA | PTIATYL. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS00551-MONOMER. |
| BRENDA | 3.1.3.66. 2681. |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00944. |
Gene expression databases | |
| ArrayExpress | Q96PE3. |
| Bgee | Q96PE3. |
| CleanEx | HS_INPP4A. |
| Genevestigator | Q96PE3. |
| GermOnline | ENSG00000040933. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. [Graphical view] |
| SMART | SM00239. C2. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. |
| PROSITE | PS50004. C2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | INPP4A. human. |
| GenomeRNAi | 3631. |
| NextBio | 14207. |
| SOURCE | Search... |
Entry information
| Entry name | INP4A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96PE3 Secondary accession number(s): O15326 Q8TC02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
