SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96PE3

- INP4A_HUMAN

UniProt

Q96PE3 - INP4A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Type I inositol 3,4-bisphosphate 4-phosphatase
Gene
INPP4A
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.

Catalytic activityi

1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate.

Pathwayi

GO - Molecular functioni

  1. phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity Source: UniProtKB-EC
  2. phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity Source: UniProtKB-EC

GO - Biological processi

  1. inositol phosphate metabolic process Source: Reactome
  2. phosphatidylinositol biosynthetic process Source: Reactome
  3. phospholipid metabolic process Source: Reactome
  4. signal transduction Source: ProtInc
  5. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BioCyciMetaCyc:HS00551-MONOMER.
BRENDAi3.1.3.66. 2681.
ReactomeiREACT_120756. Synthesis of PIPs at the early endosome membrane.
REACT_121025. Synthesis of PIPs at the plasma membrane.
REACT_150352. Synthesis of IP2, IP, and Ins in the cytosol.
UniPathwayiUPA00944.

Names & Taxonomyi

Protein namesi
Recommended name:
Type I inositol 3,4-bisphosphate 4-phosphatase (EC:3.1.3.66)
Alternative name(s):
Inositol polyphosphate 4-phosphatase type I
Gene namesi
Name:INPP4A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:6074. INPP4A.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29882.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 977977Type I inositol 3,4-bisphosphate 4-phosphatase
PRO_0000190232Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei355 – 3551Phosphotyrosine1 Publication
Modified residuei487 – 4871Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96PE3.
PaxDbiQ96PE3.
PRIDEiQ96PE3.

PTM databases

PhosphoSiteiQ96PE3.

Expressioni

Tissue specificityi

Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain.1 Publication

Gene expression databases

ArrayExpressiQ96PE3.
BgeeiQ96PE3.
CleanExiHS_INPP4A.
GenevestigatoriQ96PE3.

Organism-specific databases

HPAiHPA001628.

Interactioni

Protein-protein interaction databases

BioGridi109843. 4 interactions.
IntActiQ96PE3. 1 interaction.
MINTiMINT-1188108.
STRINGi9606.ENSP00000074304.

Structurei

3D structure databases

ProteinModelPortaliQ96PE3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini31 – 137107C2
Add
BLAST

Sequence similaritiesi

Contains 1 C2 domain.

Phylogenomic databases

eggNOGiNOG289097.
HOGENOMiHOG000113075.
HOVERGENiHBG081796.
InParanoidiQ96PE3.
KOiK01109.
OMAiTLMARWT.
PhylomeDBiQ96PE3.
TreeFamiTF325637.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96PE3-1) [UniParc]FASTAAdd to Basket

Also known as: Alpha-3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTAREHSPRH GARARAMQRA STIDVAADML GLSLAGNIQD PDEPILEFSL    50
ACSELHTPSL DRKPNSFVAV SVTTPPQAFW TKHAQTEIIE GTNNPIFLSS 100
IAFFQDSLIN QMTQVKLSVY DVKDRSQGTM YLLGSGTFIV KDLLQDRHHR 150
LHLTLRSAES DRVGNITVIG WQMEEKSDQR PPVTRSVDTV NGRMVLPVDE 200
SLTEALGIRS KYASLRKDTL LKSVFGGAIC RMYRFPTTDG NHLRILEQMA 250
ESVLSLHVPR QFVKLLLEED AARVCELEEL GELSPCWESL RRQIVTQYQT 300
IILTYQENLT DLHQYRGPSF KASSLKADKK LEFVPTNLHI QRMRVQDDGG 350
SDQNYDIVTI GAPAAHCQGF KSGGLRKKLH KFEETKKHFE ECCTSSGCQS 400
IIYIPQDVVR AKEIIAQINT LKTQVSYYAE RLSRAAKDRS ATGLERTLAI 450
LADKTRQLVT VCDCKLLANS IHGLNAARPD YIASKASPTS TEEEQVMLRN 500
DQDTLMARWT GRNSRSSLQV DWHEEEWEKV WLNVDKSLEC IIQRVDKLLQ 550
KERLHGEGCE DVFPCAGSCT SKKGNPDSHA YWIRPEDPFC DVPSSPCPST 600
MPSTACHPHL TTHCSPPPEE SSPGEWSEAL YPLLTTLTDC VAMMSDKAKK 650
AMVFLLMQDS APTIATYLSL QYRRDVVFCQ TLTALICGFI IKLRNCLHDD 700
GFLRQLYTIG LLAQFESLLS TYGEELAMLE DMSLGIMDLR NVTFKVTQAT 750
SSASADMLPV ITGNRDGFNV RVPLPGPLFD ALPREIQSGM LLRVQPVLFN 800
VGINEQQTLA ERFGDTSLQE VINVESLVRL NSYFEQFKEV LPEDCLPRSR 850
SQTCLPELLR FLGQNVHARK NKNVDILWQA AEICRRLNGV RFTSCKSAKD 900
RTAMSVTLEQ CLILQHEHGM APQVFTQALE CMRSEGCRRE NTMKNVGSRK 950
YAFNSLQLKA FPKHYRPPEG TYGKVET 977
Length:977
Mass (Da):109,956
Last modified:December 1, 2001 - v1
Checksum:i14087B24256B2D05
GO
Isoform 2 (identifier: Q96PE3-2) [UniParc]FASTAAdd to Basket

Also known as: Alpha-1

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D

Show »
Length:938
Mass (Da):105,699
Checksum:i02E47A7528C9C4F7
GO
Isoform 3 (identifier: Q96PE3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-393: Missing.

Show »
Length:972
Mass (Da):109,344
Checksum:i63238BA562D67D76
GO
Isoform 4 (identifier: Q96PE3-4) [UniParc]FASTAAdd to Basket

Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D
     935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK

Note: Inactive.

Show »
Length:954
Mass (Da):107,297
Checksum:iA0899227C8C4BA85
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti604 – 6041T → A.
Corresponds to variant rs2278206 [ dbSNP | Ensembl ].
VAR_059359

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei389 – 3935Missing in isoform 3.
VSP_015240
Alternative sequencei574 – 61340GNPDS…HLTTH → D in isoform 2 and isoform 4.
VSP_015241Add
BLAST
Alternative sequencei935 – 97743EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4.
VSP_015242Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti767 – 7671G → E in AAH28361. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U26398 mRNA. Translation: AAB01068.1.
U96919 mRNA. Translation: AAB72150.1.
AF368319 mRNA. Translation: AAK58870.1.
AC010134 Genomic DNA. Translation: AAX93230.1.
BC028361 mRNA. Translation: AAH28361.1.
CCDSiCCDS46369.1. [Q96PE3-1]
CCDS46370.1. [Q96PE3-2]
CCDS46371.1. [Q96PE3-3]
CCDS46372.1. [Q96PE3-4]
PIRiB57487.
RefSeqiNP_001127696.1. NM_001134224.1. [Q96PE3-1]
NP_001127697.1. NM_001134225.1. [Q96PE3-3]
NP_001557.1. NM_001566.2. [Q96PE3-4]
NP_004018.1. NM_004027.2. [Q96PE3-2]
UniGeneiHs.469386.

Genome annotation databases

EnsembliENST00000074304; ENSP00000074304; ENSG00000040933. [Q96PE3-1]
ENST00000409016; ENSP00000386704; ENSG00000040933. [Q96PE3-2]
ENST00000409540; ENSP00000387294; ENSG00000040933. [Q96PE3-4]
ENST00000409851; ENSP00000386777; ENSG00000040933. [Q96PE3-3]
ENST00000523221; ENSP00000427722; ENSG00000040933. [Q96PE3-1]
GeneIDi3631.
KEGGihsa:3631.
UCSCiuc002syx.3. human. [Q96PE3-3]
uc002syy.3. human. [Q96PE3-1]
uc010yvj.1. human. [Q96PE3-4]
uc010yvk.2. human. [Q96PE3-2]

Polymorphism databases

DMDMi73920059.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U26398 mRNA. Translation: AAB01068.1 .
U96919 mRNA. Translation: AAB72150.1 .
AF368319 mRNA. Translation: AAK58870.1 .
AC010134 Genomic DNA. Translation: AAX93230.1 .
BC028361 mRNA. Translation: AAH28361.1 .
CCDSi CCDS46369.1. [Q96PE3-1 ]
CCDS46370.1. [Q96PE3-2 ]
CCDS46371.1. [Q96PE3-3 ]
CCDS46372.1. [Q96PE3-4 ]
PIRi B57487.
RefSeqi NP_001127696.1. NM_001134224.1. [Q96PE3-1 ]
NP_001127697.1. NM_001134225.1. [Q96PE3-3 ]
NP_001557.1. NM_001566.2. [Q96PE3-4 ]
NP_004018.1. NM_004027.2. [Q96PE3-2 ]
UniGenei Hs.469386.

3D structure databases

ProteinModelPortali Q96PE3.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 109843. 4 interactions.
IntActi Q96PE3. 1 interaction.
MINTi MINT-1188108.
STRINGi 9606.ENSP00000074304.

PTM databases

PhosphoSitei Q96PE3.

Polymorphism databases

DMDMi 73920059.

Proteomic databases

MaxQBi Q96PE3.
PaxDbi Q96PE3.
PRIDEi Q96PE3.

Protocols and materials databases

DNASUi 3631.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000074304 ; ENSP00000074304 ; ENSG00000040933 . [Q96PE3-1 ]
ENST00000409016 ; ENSP00000386704 ; ENSG00000040933 . [Q96PE3-2 ]
ENST00000409540 ; ENSP00000387294 ; ENSG00000040933 . [Q96PE3-4 ]
ENST00000409851 ; ENSP00000386777 ; ENSG00000040933 . [Q96PE3-3 ]
ENST00000523221 ; ENSP00000427722 ; ENSG00000040933 . [Q96PE3-1 ]
GeneIDi 3631.
KEGGi hsa:3631.
UCSCi uc002syx.3. human. [Q96PE3-3 ]
uc002syy.3. human. [Q96PE3-1 ]
uc010yvj.1. human. [Q96PE3-4 ]
uc010yvk.2. human. [Q96PE3-2 ]

Organism-specific databases

CTDi 3631.
GeneCardsi GC02P099061.
HGNCi HGNC:6074. INPP4A.
HPAi HPA001628.
MIMi 600916. gene.
neXtProti NX_Q96PE3.
PharmGKBi PA29882.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG289097.
HOGENOMi HOG000113075.
HOVERGENi HBG081796.
InParanoidi Q96PE3.
KOi K01109.
OMAi TLMARWT.
PhylomeDBi Q96PE3.
TreeFami TF325637.

Enzyme and pathway databases

UniPathwayi UPA00944 .
BioCyci MetaCyc:HS00551-MONOMER.
BRENDAi 3.1.3.66. 2681.
Reactomei REACT_120756. Synthesis of PIPs at the early endosome membrane.
REACT_121025. Synthesis of PIPs at the plasma membrane.
REACT_150352. Synthesis of IP2, IP, and Ins in the cytosol.

Miscellaneous databases

ChiTaRSi INPP4A. human.
GeneWikii INPP4A.
GenomeRNAii 3631.
NextBioi 14207.
PROi Q96PE3.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96PE3.
Bgeei Q96PE3.
CleanExi HS_INPP4A.
Genevestigatori Q96PE3.

Family and domain databases

Gene3Di 2.60.40.150. 1 hit.
InterProi IPR000008. C2_dom.
[Graphical view ]
SMARTi SM00239. C2. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase."
    Norris F.A., Auethavekiat V., Majerus P.W.
    J. Biol. Chem. 270:16128-16133(1995) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family."
    Norris F.A., Atkins R.C., Majerus P.W.
    J. Biol. Chem. 272:23859-23864(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Brain.
  3. "Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene."
    Shearn C.T., Walker J., Norris F.A.
    Biochem. Biophys. Res. Commun. 286:119-125(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Testis.
  6. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
    Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
    Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-355, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiINP4A_HUMAN
AccessioniPrimary (citable) accession number: Q96PE3
Secondary accession number(s): O15326
, Q13187, Q53TD8, Q8TC02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi