Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96PE3

- INP4A_HUMAN

UniProt

Q96PE3 - INP4A_HUMAN

Protein

Type I inositol 3,4-bisphosphate 4-phosphatase

Gene

INPP4A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.

    Catalytic activityi

    1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate.

    Pathwayi

    GO - Molecular functioni

    1. phosphatidylinositol-3,4-bisphosphate 4-phosphatase activity Source: UniProtKB-EC
    2. phosphatidylinositol-4,5-bisphosphate 4-phosphatase activity Source: UniProtKB-EC

    GO - Biological processi

    1. inositol phosphate metabolic process Source: Reactome
    2. phosphatidylinositol biosynthetic process Source: Reactome
    3. phospholipid metabolic process Source: Reactome
    4. signal transduction Source: ProtInc
    5. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Hydrolase

    Enzyme and pathway databases

    BioCyciMetaCyc:HS00551-MONOMER.
    BRENDAi3.1.3.66. 2681.
    ReactomeiREACT_120756. Synthesis of PIPs at the early endosome membrane.
    REACT_121025. Synthesis of PIPs at the plasma membrane.
    REACT_150352. Synthesis of IP2, IP, and Ins in the cytosol.
    UniPathwayiUPA00944.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Type I inositol 3,4-bisphosphate 4-phosphatase (EC:3.1.3.66)
    Alternative name(s):
    Inositol polyphosphate 4-phosphatase type I
    Gene namesi
    Name:INPP4A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:6074. INPP4A.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA29882.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 977977Type I inositol 3,4-bisphosphate 4-phosphatasePRO_0000190232Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei355 – 3551Phosphotyrosine1 Publication
    Modified residuei487 – 4871Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ96PE3.
    PaxDbiQ96PE3.
    PRIDEiQ96PE3.

    PTM databases

    PhosphoSiteiQ96PE3.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain.1 Publication

    Gene expression databases

    ArrayExpressiQ96PE3.
    BgeeiQ96PE3.
    CleanExiHS_INPP4A.
    GenevestigatoriQ96PE3.

    Organism-specific databases

    HPAiHPA001628.

    Interactioni

    Protein-protein interaction databases

    BioGridi109843. 4 interactions.
    IntActiQ96PE3. 1 interaction.
    MINTiMINT-1188108.
    STRINGi9606.ENSP00000074304.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96PE3.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini31 – 137107C2Add
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.Curated

    Phylogenomic databases

    eggNOGiNOG289097.
    HOGENOMiHOG000113075.
    HOVERGENiHBG081796.
    InParanoidiQ96PE3.
    KOiK01109.
    OMAiTLMARWT.
    PhylomeDBiQ96PE3.
    TreeFamiTF325637.

    Family and domain databases

    Gene3Di2.60.40.150. 1 hit.
    InterProiIPR000008. C2_dom.
    [Graphical view]
    SMARTiSM00239. C2. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96PE3-1) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-3

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTAREHSPRH GARARAMQRA STIDVAADML GLSLAGNIQD PDEPILEFSL    50
    ACSELHTPSL DRKPNSFVAV SVTTPPQAFW TKHAQTEIIE GTNNPIFLSS 100
    IAFFQDSLIN QMTQVKLSVY DVKDRSQGTM YLLGSGTFIV KDLLQDRHHR 150
    LHLTLRSAES DRVGNITVIG WQMEEKSDQR PPVTRSVDTV NGRMVLPVDE 200
    SLTEALGIRS KYASLRKDTL LKSVFGGAIC RMYRFPTTDG NHLRILEQMA 250
    ESVLSLHVPR QFVKLLLEED AARVCELEEL GELSPCWESL RRQIVTQYQT 300
    IILTYQENLT DLHQYRGPSF KASSLKADKK LEFVPTNLHI QRMRVQDDGG 350
    SDQNYDIVTI GAPAAHCQGF KSGGLRKKLH KFEETKKHFE ECCTSSGCQS 400
    IIYIPQDVVR AKEIIAQINT LKTQVSYYAE RLSRAAKDRS ATGLERTLAI 450
    LADKTRQLVT VCDCKLLANS IHGLNAARPD YIASKASPTS TEEEQVMLRN 500
    DQDTLMARWT GRNSRSSLQV DWHEEEWEKV WLNVDKSLEC IIQRVDKLLQ 550
    KERLHGEGCE DVFPCAGSCT SKKGNPDSHA YWIRPEDPFC DVPSSPCPST 600
    MPSTACHPHL TTHCSPPPEE SSPGEWSEAL YPLLTTLTDC VAMMSDKAKK 650
    AMVFLLMQDS APTIATYLSL QYRRDVVFCQ TLTALICGFI IKLRNCLHDD 700
    GFLRQLYTIG LLAQFESLLS TYGEELAMLE DMSLGIMDLR NVTFKVTQAT 750
    SSASADMLPV ITGNRDGFNV RVPLPGPLFD ALPREIQSGM LLRVQPVLFN 800
    VGINEQQTLA ERFGDTSLQE VINVESLVRL NSYFEQFKEV LPEDCLPRSR 850
    SQTCLPELLR FLGQNVHARK NKNVDILWQA AEICRRLNGV RFTSCKSAKD 900
    RTAMSVTLEQ CLILQHEHGM APQVFTQALE CMRSEGCRRE NTMKNVGSRK 950
    YAFNSLQLKA FPKHYRPPEG TYGKVET 977
    Length:977
    Mass (Da):109,956
    Last modified:December 1, 2001 - v1
    Checksum:i14087B24256B2D05
    GO
    Isoform 2 (identifier: Q96PE3-2) [UniParc]FASTAAdd to Basket

    Also known as: Alpha-1

    The sequence of this isoform differs from the canonical sequence as follows:
         574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D

    Show »
    Length:938
    Mass (Da):105,699
    Checksum:i02E47A7528C9C4F7
    GO
    Isoform 3 (identifier: Q96PE3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         389-393: Missing.

    Show »
    Length:972
    Mass (Da):109,344
    Checksum:i63238BA562D67D76
    GO
    Isoform 4 (identifier: Q96PE3-4) [UniParc]FASTAAdd to Basket

    Also known as: Beta

    The sequence of this isoform differs from the canonical sequence as follows:
         574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D
         935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK

    Note: Inactive.

    Show »
    Length:954
    Mass (Da):107,297
    Checksum:iA0899227C8C4BA85
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti767 – 7671G → E in AAH28361. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti604 – 6041T → A.
    Corresponds to variant rs2278206 [ dbSNP | Ensembl ].
    VAR_059359

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei389 – 3935Missing in isoform 3. 1 PublicationVSP_015240
    Alternative sequencei574 – 61340GNPDS…HLTTH → D in isoform 2 and isoform 4. 2 PublicationsVSP_015241Add
    BLAST
    Alternative sequencei935 – 97743EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4. 1 PublicationVSP_015242Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26398 mRNA. Translation: AAB01068.1.
    U96919 mRNA. Translation: AAB72150.1.
    AF368319 mRNA. Translation: AAK58870.1.
    AC010134 Genomic DNA. Translation: AAX93230.1.
    BC028361 mRNA. Translation: AAH28361.1.
    CCDSiCCDS46369.1. [Q96PE3-1]
    CCDS46370.1. [Q96PE3-2]
    CCDS46371.1. [Q96PE3-3]
    CCDS46372.1. [Q96PE3-4]
    PIRiB57487.
    RefSeqiNP_001127696.1. NM_001134224.1. [Q96PE3-1]
    NP_001127697.1. NM_001134225.1. [Q96PE3-3]
    NP_001557.1. NM_001566.2. [Q96PE3-4]
    NP_004018.1. NM_004027.2. [Q96PE3-2]
    UniGeneiHs.469386.

    Genome annotation databases

    EnsembliENST00000074304; ENSP00000074304; ENSG00000040933. [Q96PE3-1]
    ENST00000409016; ENSP00000386704; ENSG00000040933. [Q96PE3-2]
    ENST00000409540; ENSP00000387294; ENSG00000040933. [Q96PE3-4]
    ENST00000409851; ENSP00000386777; ENSG00000040933. [Q96PE3-3]
    ENST00000523221; ENSP00000427722; ENSG00000040933. [Q96PE3-1]
    GeneIDi3631.
    KEGGihsa:3631.
    UCSCiuc002syx.3. human. [Q96PE3-3]
    uc002syy.3. human. [Q96PE3-1]
    uc010yvj.1. human. [Q96PE3-4]
    uc010yvk.2. human. [Q96PE3-2]

    Polymorphism databases

    DMDMi73920059.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U26398 mRNA. Translation: AAB01068.1 .
    U96919 mRNA. Translation: AAB72150.1 .
    AF368319 mRNA. Translation: AAK58870.1 .
    AC010134 Genomic DNA. Translation: AAX93230.1 .
    BC028361 mRNA. Translation: AAH28361.1 .
    CCDSi CCDS46369.1. [Q96PE3-1 ]
    CCDS46370.1. [Q96PE3-2 ]
    CCDS46371.1. [Q96PE3-3 ]
    CCDS46372.1. [Q96PE3-4 ]
    PIRi B57487.
    RefSeqi NP_001127696.1. NM_001134224.1. [Q96PE3-1 ]
    NP_001127697.1. NM_001134225.1. [Q96PE3-3 ]
    NP_001557.1. NM_001566.2. [Q96PE3-4 ]
    NP_004018.1. NM_004027.2. [Q96PE3-2 ]
    UniGenei Hs.469386.

    3D structure databases

    ProteinModelPortali Q96PE3.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 109843. 4 interactions.
    IntActi Q96PE3. 1 interaction.
    MINTi MINT-1188108.
    STRINGi 9606.ENSP00000074304.

    PTM databases

    PhosphoSitei Q96PE3.

    Polymorphism databases

    DMDMi 73920059.

    Proteomic databases

    MaxQBi Q96PE3.
    PaxDbi Q96PE3.
    PRIDEi Q96PE3.

    Protocols and materials databases

    DNASUi 3631.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000074304 ; ENSP00000074304 ; ENSG00000040933 . [Q96PE3-1 ]
    ENST00000409016 ; ENSP00000386704 ; ENSG00000040933 . [Q96PE3-2 ]
    ENST00000409540 ; ENSP00000387294 ; ENSG00000040933 . [Q96PE3-4 ]
    ENST00000409851 ; ENSP00000386777 ; ENSG00000040933 . [Q96PE3-3 ]
    ENST00000523221 ; ENSP00000427722 ; ENSG00000040933 . [Q96PE3-1 ]
    GeneIDi 3631.
    KEGGi hsa:3631.
    UCSCi uc002syx.3. human. [Q96PE3-3 ]
    uc002syy.3. human. [Q96PE3-1 ]
    uc010yvj.1. human. [Q96PE3-4 ]
    uc010yvk.2. human. [Q96PE3-2 ]

    Organism-specific databases

    CTDi 3631.
    GeneCardsi GC02P099061.
    HGNCi HGNC:6074. INPP4A.
    HPAi HPA001628.
    MIMi 600916. gene.
    neXtProti NX_Q96PE3.
    PharmGKBi PA29882.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG289097.
    HOGENOMi HOG000113075.
    HOVERGENi HBG081796.
    InParanoidi Q96PE3.
    KOi K01109.
    OMAi TLMARWT.
    PhylomeDBi Q96PE3.
    TreeFami TF325637.

    Enzyme and pathway databases

    UniPathwayi UPA00944 .
    BioCyci MetaCyc:HS00551-MONOMER.
    BRENDAi 3.1.3.66. 2681.
    Reactomei REACT_120756. Synthesis of PIPs at the early endosome membrane.
    REACT_121025. Synthesis of PIPs at the plasma membrane.
    REACT_150352. Synthesis of IP2, IP, and Ins in the cytosol.

    Miscellaneous databases

    ChiTaRSi INPP4A. human.
    GeneWikii INPP4A.
    GenomeRNAii 3631.
    NextBioi 14207.
    PROi Q96PE3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96PE3.
    Bgeei Q96PE3.
    CleanExi HS_INPP4A.
    Genevestigatori Q96PE3.

    Family and domain databases

    Gene3Di 2.60.40.150. 1 hit.
    InterProi IPR000008. C2_dom.
    [Graphical view ]
    SMARTi SM00239. C2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase."
      Norris F.A., Auethavekiat V., Majerus P.W.
      J. Biol. Chem. 270:16128-16133(1995) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Brain.
    2. "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family."
      Norris F.A., Atkins R.C., Majerus P.W.
      J. Biol. Chem. 272:23859-23864(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: Brain.
    3. "Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene."
      Shearn C.T., Walker J., Norris F.A.
      Biochem. Biophys. Res. Commun. 286:119-125(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Testis.
    6. "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
      Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
      Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-355, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiINP4A_HUMAN
    AccessioniPrimary (citable) accession number: Q96PE3
    Secondary accession number(s): O15326
    , Q13187, Q53TD8, Q8TC02
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 30, 2005
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 90 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3