Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96PE3 (INP4A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 85. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Type I inositol 3,4-bisphosphate 4-phosphatase

EC=3.1.3.66
Alternative name(s):
Inositol polyphosphate 4-phosphatase type I
Gene names
Name:INPP4A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length977 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.

Catalytic activity

1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate.

Pathway

Signal transduction; phosphatidylinositol signaling pathway.

Tissue specificity

Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain. Ref.3

Sequence similarities

Belongs to the inositol 3,4-bisphosphate 4-phosphatase family.

Contains 1 C2 domain.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96PE3-1)

Also known as: Alpha-3;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96PE3-2)

Also known as: Alpha-1;

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D
Isoform 3 (identifier: Q96PE3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     389-393: Missing.
Isoform 4 (identifier: Q96PE3-4)

Also known as: Beta;

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D
     935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK
Note: Inactive.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 977977Type I inositol 3,4-bisphosphate 4-phosphatase
PRO_0000190232

Regions

Domain31 – 137107C2

Amino acid modifications

Modified residue3551Phosphotyrosine Ref.6
Modified residue4871Phosphoserine Ref.7

Natural variations

Alternative sequence389 – 3935Missing in isoform 3.
VSP_015240
Alternative sequence574 – 61340GNPDS…HLTTH → D in isoform 2 and isoform 4.
VSP_015241
Alternative sequence935 – 97743EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4.
VSP_015242
Natural variant6041T → A.
Corresponds to variant rs2278206 [ dbSNP | Ensembl ].
VAR_059359

Experimental info

Sequence conflict7671G → E in AAH28361. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Alpha-3) [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 14087B24256B2D05

FASTA977109,956
        10         20         30         40         50         60 
MTAREHSPRH GARARAMQRA STIDVAADML GLSLAGNIQD PDEPILEFSL ACSELHTPSL 

        70         80         90        100        110        120 
DRKPNSFVAV SVTTPPQAFW TKHAQTEIIE GTNNPIFLSS IAFFQDSLIN QMTQVKLSVY 

       130        140        150        160        170        180 
DVKDRSQGTM YLLGSGTFIV KDLLQDRHHR LHLTLRSAES DRVGNITVIG WQMEEKSDQR 

       190        200        210        220        230        240 
PPVTRSVDTV NGRMVLPVDE SLTEALGIRS KYASLRKDTL LKSVFGGAIC RMYRFPTTDG 

       250        260        270        280        290        300 
NHLRILEQMA ESVLSLHVPR QFVKLLLEED AARVCELEEL GELSPCWESL RRQIVTQYQT 

       310        320        330        340        350        360 
IILTYQENLT DLHQYRGPSF KASSLKADKK LEFVPTNLHI QRMRVQDDGG SDQNYDIVTI 

       370        380        390        400        410        420 
GAPAAHCQGF KSGGLRKKLH KFEETKKHFE ECCTSSGCQS IIYIPQDVVR AKEIIAQINT 

       430        440        450        460        470        480 
LKTQVSYYAE RLSRAAKDRS ATGLERTLAI LADKTRQLVT VCDCKLLANS IHGLNAARPD 

       490        500        510        520        530        540 
YIASKASPTS TEEEQVMLRN DQDTLMARWT GRNSRSSLQV DWHEEEWEKV WLNVDKSLEC 

       550        560        570        580        590        600 
IIQRVDKLLQ KERLHGEGCE DVFPCAGSCT SKKGNPDSHA YWIRPEDPFC DVPSSPCPST 

       610        620        630        640        650        660 
MPSTACHPHL TTHCSPPPEE SSPGEWSEAL YPLLTTLTDC VAMMSDKAKK AMVFLLMQDS 

       670        680        690        700        710        720 
APTIATYLSL QYRRDVVFCQ TLTALICGFI IKLRNCLHDD GFLRQLYTIG LLAQFESLLS 

       730        740        750        760        770        780 
TYGEELAMLE DMSLGIMDLR NVTFKVTQAT SSASADMLPV ITGNRDGFNV RVPLPGPLFD 

       790        800        810        820        830        840 
ALPREIQSGM LLRVQPVLFN VGINEQQTLA ERFGDTSLQE VINVESLVRL NSYFEQFKEV 

       850        860        870        880        890        900 
LPEDCLPRSR SQTCLPELLR FLGQNVHARK NKNVDILWQA AEICRRLNGV RFTSCKSAKD 

       910        920        930        940        950        960 
RTAMSVTLEQ CLILQHEHGM APQVFTQALE CMRSEGCRRE NTMKNVGSRK YAFNSLQLKA 

       970 
FPKHYRPPEG TYGKVET 

« Hide

Isoform 2 (Alpha-1) [UniParc].

Checksum: 02E47A7528C9C4F7
Show »

FASTA938105,699
Isoform 3 [UniParc].

Checksum: 63238BA562D67D76
Show »

FASTA972109,344
Isoform 4 (Beta) [UniParc].

Checksum: A0899227C8C4BA85
Show »

FASTA954107,297

References

« Hide 'large scale' references
[1]"The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase."
Norris F.A., Auethavekiat V., Majerus P.W.
J. Biol. Chem. 270:16128-16133(1995) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Brain.
[2]"The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family."
Norris F.A., Atkins R.C., Majerus P.W.
J. Biol. Chem. 272:23859-23864(1997) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
Tissue: Brain.
[3]"Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene."
Shearn C.T., Walker J., Norris F.A.
Biochem. Biophys. Res. Commun. 286:119-125(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[4]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Testis.
[6]"Immunoaffinity profiling of tyrosine phosphorylation in cancer cells."
Rush J., Moritz A., Lee K.A., Guo A., Goss V.L., Spek E.J., Zhang H., Zha X.-M., Polakiewicz R.D., Comb M.J.
Nat. Biotechnol. 23:94-101(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-355, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-487, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
U26398 mRNA. Translation: AAB01068.1.
U96919 mRNA. Translation: AAB72150.1.
AF368319 mRNA. Translation: AAK58870.1.
AC010134 Genomic DNA. Translation: AAX93230.1.
BC028361 mRNA. Translation: AAH28361.1.
PIRB57487.
RefSeqNP_001127696.1. NM_001134224.1.
NP_001127697.1. NM_001134225.1.
NP_001557.1. NM_001566.2.
NP_004018.1. NM_004027.2.
UniGeneHs.469386.

3D structure databases

ProteinModelPortalQ96PE3.
SMRQ96PE3. Positions 45-158.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid109843. 4 interactions.
IntActQ96PE3. 1 interaction.
MINTMINT-1188108.
STRING9606.ENSP00000074304.

PTM databases

PhosphoSiteQ96PE3.

Polymorphism databases

DMDM73920059.

Proteomic databases

PaxDbQ96PE3.
PRIDEQ96PE3.

Protocols and materials databases

DNASU3631.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000074304; ENSP00000074304; ENSG00000040933. [Q96PE3-1]
ENST00000409016; ENSP00000386704; ENSG00000040933. [Q96PE3-2]
ENST00000409540; ENSP00000387294; ENSG00000040933. [Q96PE3-4]
ENST00000409851; ENSP00000386777; ENSG00000040933. [Q96PE3-3]
ENST00000523221; ENSP00000427722; ENSG00000040933. [Q96PE3-1]
GeneID3631.
KEGGhsa:3631.
UCSCuc002syx.3. human. [Q96PE3-3]
uc002syy.3. human. [Q96PE3-1]
uc010yvj.1. human. [Q96PE3-4]
uc010yvk.2. human. [Q96PE3-2]

Organism-specific databases

CTD3631.
GeneCardsGC02P099061.
HGNCHGNC:6074. INPP4A.
HPAHPA001628.
MIM600916. gene.
neXtProtNX_Q96PE3.
PharmGKBPA29882.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG289097.
HOGENOMHOG000113075.
HOVERGENHBG081796.
InParanoidQ96PE3.
KOK01109.
OMAARWTGRN.
PhylomeDBQ96PE3.
TreeFamTF325637.

Enzyme and pathway databases

BioCycMetaCyc:HS00551-MONOMER.
BRENDA3.1.3.66. 2681.
ReactomeREACT_111217. Metabolism.
UniPathwayUPA00944.

Gene expression databases

ArrayExpressQ96PE3.
BgeeQ96PE3.
CleanExHS_INPP4A.
GenevestigatorQ96PE3.

Family and domain databases

Gene3D2.60.40.150. 1 hit.
InterProIPR000008. C2_dom.
[Graphical view]
SMARTSM00239. C2. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
ProtoNetSearch...

Other

ChiTaRSINPP4A. human.
GeneWikiINPP4A.
GenomeRNAi3631.
NextBio14207.
PROQ96PE3.
SOURCESearch...

Entry information

Entry nameINP4A_HUMAN
AccessionPrimary (citable) accession number: Q96PE3
Secondary accession number(s): O15326 expand/collapse secondary AC list , Q13187, Q53TD8, Q8TC02
Entry history
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM