Reviewed,
UniProtKB/Swiss-Prot Q96PE3 (INP4A_HUMAN)
Last modified
March 24, 2009.
Version 44.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Type I inositol-3,4-bisphosphate 4-phosphatase EC=3.1.3.66 Alternative name(s): Inositol polyphosphate 4-phosphatase type I | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 977 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate. |
| Catalytic activity | 1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate. |
| Pathway | Signal transduction; phosphatidylinositol signaling pathway. |
| Tissue specificity | Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain. Ref.3 |
| Sequence similarities | Belongs to the inositol-3,4-bisphosphate 4-phosphatase family. Contains 1 C2 domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| Gene Ontology (GO) | |
| Biological process | signal transduction Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | phosphatidyl-inositol-4,5-bisphosphate 4-phosphatase activity Inferred from electronic annotation. Source: EC phosphatidylinositol-3,4-bisphosphate 4-phosphatase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96PE3-1) Also known as: Alpha-3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96PE3-2) Also known as: Alpha-1; The sequence of this isoform differs from the canonical sequence as follows: 574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D | ||||||
| Isoform 3 (identifier: Q96PE3-3) The sequence of this isoform differs from the canonical sequence as follows: 389-393: Missing. | ||||||
| Isoform 4 (identifier: Q96PE3-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D 935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK | ||||||
| Note: Inactive. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 977 | 977 | Type I inositol-3,4-bisphosphate 4-phosphatase | PRO_0000190232 | |||||
Regions | |||||||||
| Domain | 31 – 137 | 107 | C2 | ||||||
Natural variations | |||||||||
| Alternative sequence | 389 – 393 | 5 | Missing in isoform 3. | VSP_015240 | |||||
| Alternative sequence | 574 – 613 | 40 | GNPDS…HLTTH → D in isoform 2 and isoform 4. | VSP_015241 | |||||
| Alternative sequence | 935 – 977 | 43 | EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4. | VSP_015242 | |||||
Experimental info | |||||||||
| Sequence conflict | 767 | 1 | G → E in AAH28361. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The isolation and characterization of cDNA encoding human and rat brain inositol polyphosphate 4-phosphatase." Norris F.A., Auethavekiat V., Majerus P.W. J. Biol. Chem. 270:16128-16133(1995) [PubMed: 7608176] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [2] | "The cDNA cloning and characterization of inositol polyphosphate 4-phosphatase type II. Evidence for conserved alternative splicing in the 4-phosphatase family." Norris F.A., Atkins R.C., Majerus P.W. J. Biol. Chem. 272:23859-23864(1997) [PubMed: 9295334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Brain. |
| [3] | "Identification of a novel spliceoform of inositol polyphosphate 4-phosphatase type Ialpha expressed in human platelets: structure of human inositol polyphosphate 4-phosphatase type I gene." Shearn C.T., Walker J., Norris F.A. Biochem. Biophys. Res. Commun. 286:119-125(2001) [PubMed: 11485317] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| U26398 mRNA. Translation: AAB01068.1. U96919 mRNA. Translation: AAB72150.1. AF368319 mRNA. Translation: AAK58870.1. AC010134 Genomic DNA. Translation: AAX93230.1. BC028361 mRNA. Translation: AAH28361.1. | |
| IPI | IPI00044388. IPI00215830. IPI00645392. IPI00916254. |
| PIR | B57487. |
| RefSeq | NP_001127696.1. NP_001127697.1. NP_001557.1. NP_004018.1. |
| UniGene | Hs.580527 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q96PE3. |
2-D gel databases | |
| OGP | Q13187. |
Proteomic databases | |
| PRIDE | Q96PE3. |
Genome annotation databases | |
| Ensembl | ENSG00000040933. Homo sapiens. [Contig view] |
| GeneID | 3631. |
| KEGG | hsa:3631. |
Organism-specific databases | |
| GeneCards | GC02P098465. |
| H-InvDB | HIX0002297. |
| HGNC | HGNC:6074. INPP4A. |
| MIM | 600916. gene. |
| PharmGKB | PA29882. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q96PE3. |
| HOVERGEN | Q96PE3. |
Enzyme and pathway databases | |
| BRENDA | 3.1.3.66. 247. |
Gene expression databases | |
| ArrayExpress | Q96PE3. |
| Bgee | Q96PE3. |
| CleanEx | HS_INPP4A. |
| GermOnline | ENSG00000040933. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. [Graphical view] |
| SMART | SM00239. C2. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 14207. |
| SOURCE | Search... |
Entry information
| Entry name | INP4A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96PE3 Secondary accession number(s): O15326 Q8TC02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


