Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Type I inositol 3,4-bisphosphate 4-phosphatase

Gene

INPP4A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the hydrolysis of the 4-position phosphate of phosphatidylinositol 3,4-bisphosphate, inositol 1,3,4-trisphosphate and inositol 3,4-bisphosphate.

Catalytic activityi

1-phosphatidyl-myo-inositol 3,4-bisphosphate + H2O = 1-phosphatidyl-1D-myo-inositol 3-phosphate + phosphate.

Pathwayi: phosphatidylinositol signaling pathway

This protein is involved in the pathway phosphatidylinositol signaling pathway, which is part of Signal transduction.
View all proteins of this organism that are known to be involved in the pathway phosphatidylinositol signaling pathway and in Signal transduction.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BioCyciMetaCyc:HS00551-MONOMER.
ZFISH:HS00551-MONOMER.
BRENDAi3.1.3.66. 2681.
ReactomeiR-HSA-1660499. Synthesis of PIPs at the plasma membrane.
R-HSA-1660516. Synthesis of PIPs at the early endosome membrane.
R-HSA-1855183. Synthesis of IP2, IP, and Ins in the cytosol.
UniPathwayiUPA00944.

Chemistry databases

SwissLipidsiSLP:000000900.

Names & Taxonomyi

Protein namesi
Recommended name:
Type I inositol 3,4-bisphosphate 4-phosphatase (EC:3.1.3.66)
Alternative name(s):
Inositol polyphosphate 4-phosphatase type I
Gene namesi
Name:INPP4A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:6074. INPP4A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi3631.
OpenTargetsiENSG00000040933.
PharmGKBiPA29882.

Polymorphism and mutation databases

BioMutaiINPP4A.
DMDMi73920059.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001902321 – 977Type I inositol 3,4-bisphosphate 4-phosphataseAdd BLAST977

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei355PhosphotyrosineCombined sources1
Modified residuei487PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96PE3.
MaxQBiQ96PE3.
PaxDbiQ96PE3.
PeptideAtlasiQ96PE3.
PRIDEiQ96PE3.

PTM databases

DEPODiQ96PE3.
iPTMnetiQ96PE3.
PhosphoSitePlusiQ96PE3.

Expressioni

Tissue specificityi

Isoform 1 is expressed in the platelets, MEG-01 megakaryocytes and Jurkat T-cells. Isoform 2 is expressed in the brain.1 Publication

Gene expression databases

BgeeiENSG00000040933.
CleanExiHS_INPP4A.
ExpressionAtlasiQ96PE3. baseline and differential.
GenevisibleiQ96PE3. HS.

Organism-specific databases

HPAiHPA001628.

Interactioni

Subunit structurei

Interacts with INPP5F.1 Publication

Protein-protein interaction databases

BioGridi109843. 6 interactors.
IntActiQ96PE3. 1 interactor.
MINTiMINT-1188108.
STRINGi9606.ENSP00000074304.

Structurei

3D structure databases

ProteinModelPortaliQ96PE3.
SMRiQ96PE3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini31 – 137C2Add BLAST107

Sequence similaritiesi

Contains 1 C2 domain.Curated

Phylogenomic databases

eggNOGiKOG4428. Eukaryota.
ENOG410YV83. LUCA.
GeneTreeiENSGT00390000002033.
HOGENOMiHOG000113075.
HOVERGENiHBG081796.
InParanoidiQ96PE3.
KOiK01109.
OMAiTTHCSPP.
OrthoDBiEOG091G02IJ.
PhylomeDBiQ96PE3.
TreeFamiTF325637.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96PE3-1) [UniParc]FASTAAdd to basket
Also known as: Alpha-3

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAREHSPRH GARARAMQRA STIDVAADML GLSLAGNIQD PDEPILEFSL
60 70 80 90 100
ACSELHTPSL DRKPNSFVAV SVTTPPQAFW TKHAQTEIIE GTNNPIFLSS
110 120 130 140 150
IAFFQDSLIN QMTQVKLSVY DVKDRSQGTM YLLGSGTFIV KDLLQDRHHR
160 170 180 190 200
LHLTLRSAES DRVGNITVIG WQMEEKSDQR PPVTRSVDTV NGRMVLPVDE
210 220 230 240 250
SLTEALGIRS KYASLRKDTL LKSVFGGAIC RMYRFPTTDG NHLRILEQMA
260 270 280 290 300
ESVLSLHVPR QFVKLLLEED AARVCELEEL GELSPCWESL RRQIVTQYQT
310 320 330 340 350
IILTYQENLT DLHQYRGPSF KASSLKADKK LEFVPTNLHI QRMRVQDDGG
360 370 380 390 400
SDQNYDIVTI GAPAAHCQGF KSGGLRKKLH KFEETKKHFE ECCTSSGCQS
410 420 430 440 450
IIYIPQDVVR AKEIIAQINT LKTQVSYYAE RLSRAAKDRS ATGLERTLAI
460 470 480 490 500
LADKTRQLVT VCDCKLLANS IHGLNAARPD YIASKASPTS TEEEQVMLRN
510 520 530 540 550
DQDTLMARWT GRNSRSSLQV DWHEEEWEKV WLNVDKSLEC IIQRVDKLLQ
560 570 580 590 600
KERLHGEGCE DVFPCAGSCT SKKGNPDSHA YWIRPEDPFC DVPSSPCPST
610 620 630 640 650
MPSTACHPHL TTHCSPPPEE SSPGEWSEAL YPLLTTLTDC VAMMSDKAKK
660 670 680 690 700
AMVFLLMQDS APTIATYLSL QYRRDVVFCQ TLTALICGFI IKLRNCLHDD
710 720 730 740 750
GFLRQLYTIG LLAQFESLLS TYGEELAMLE DMSLGIMDLR NVTFKVTQAT
760 770 780 790 800
SSASADMLPV ITGNRDGFNV RVPLPGPLFD ALPREIQSGM LLRVQPVLFN
810 820 830 840 850
VGINEQQTLA ERFGDTSLQE VINVESLVRL NSYFEQFKEV LPEDCLPRSR
860 870 880 890 900
SQTCLPELLR FLGQNVHARK NKNVDILWQA AEICRRLNGV RFTSCKSAKD
910 920 930 940 950
RTAMSVTLEQ CLILQHEHGM APQVFTQALE CMRSEGCRRE NTMKNVGSRK
960 970
YAFNSLQLKA FPKHYRPPEG TYGKVET
Length:977
Mass (Da):109,956
Last modified:December 1, 2001 - v1
Checksum:i14087B24256B2D05
GO
Isoform 2 (identifier: Q96PE3-2) [UniParc]FASTAAdd to basket
Also known as: Alpha-1

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D

Show »
Length:938
Mass (Da):105,699
Checksum:i02E47A7528C9C4F7
GO
Isoform 3 (identifier: Q96PE3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-393: Missing.

Show »
Length:972
Mass (Da):109,344
Checksum:i63238BA562D67D76
GO
Isoform 4 (identifier: Q96PE3-4) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     574-613: GNPDSHAYWIRPEDPFCDVPSSPCPSTMPSTACHPHLTTH → D
     935-977: EGCRRENTMK...PEGTYGKVET → IGTREVVTQK...AYLVTKLRCK

Note: Inactive.
Show »
Length:954
Mass (Da):107,297
Checksum:iA0899227C8C4BA85
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti767G → E in AAH28361 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059359604T → A.Corresponds to variant rs2278206dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_015240389 – 393Missing in isoform 3. 1 Publication5
Alternative sequenceiVSP_015241574 – 613GNPDS…HLTTH → D in isoform 2 and isoform 4. 2 PublicationsAdd BLAST40
Alternative sequenceiVSP_015242935 – 977EGCRR…GKVET → IGTREVVTQKNLSGLVPIRD LRLDPSLLCSIPLLALSPNL LIVWLFLSIAYLVTKLRCK in isoform 4. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26398 mRNA. Translation: AAB01068.1.
U96919 mRNA. Translation: AAB72150.1.
AF368319 mRNA. Translation: AAK58870.1.
AC010134 Genomic DNA. Translation: AAX93230.1.
BC028361 mRNA. Translation: AAH28361.1.
CCDSiCCDS46369.1. [Q96PE3-1]
CCDS46370.1. [Q96PE3-2]
CCDS46371.1. [Q96PE3-3]
CCDS46372.1. [Q96PE3-4]
PIRiB57487.
RefSeqiNP_001127696.1. NM_001134224.1. [Q96PE3-1]
NP_001127697.1. NM_001134225.1. [Q96PE3-3]
NP_001557.1. NM_001566.2. [Q96PE3-4]
NP_004018.1. NM_004027.2. [Q96PE3-2]
XP_016859487.1. XM_017003998.1. [Q96PE3-2]
UniGeneiHs.469386.

Genome annotation databases

EnsembliENST00000074304; ENSP00000074304; ENSG00000040933. [Q96PE3-1]
ENST00000409016; ENSP00000386704; ENSG00000040933. [Q96PE3-2]
ENST00000409540; ENSP00000387294; ENSG00000040933. [Q96PE3-4]
ENST00000409851; ENSP00000386777; ENSG00000040933. [Q96PE3-3]
ENST00000523221; ENSP00000427722; ENSG00000040933. [Q96PE3-1]
GeneIDi3631.
KEGGihsa:3631.
UCSCiuc002syx.4. human. [Q96PE3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U26398 mRNA. Translation: AAB01068.1.
U96919 mRNA. Translation: AAB72150.1.
AF368319 mRNA. Translation: AAK58870.1.
AC010134 Genomic DNA. Translation: AAX93230.1.
BC028361 mRNA. Translation: AAH28361.1.
CCDSiCCDS46369.1. [Q96PE3-1]
CCDS46370.1. [Q96PE3-2]
CCDS46371.1. [Q96PE3-3]
CCDS46372.1. [Q96PE3-4]
PIRiB57487.
RefSeqiNP_001127696.1. NM_001134224.1. [Q96PE3-1]
NP_001127697.1. NM_001134225.1. [Q96PE3-3]
NP_001557.1. NM_001566.2. [Q96PE3-4]
NP_004018.1. NM_004027.2. [Q96PE3-2]
XP_016859487.1. XM_017003998.1. [Q96PE3-2]
UniGeneiHs.469386.

3D structure databases

ProteinModelPortaliQ96PE3.
SMRiQ96PE3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109843. 6 interactors.
IntActiQ96PE3. 1 interactor.
MINTiMINT-1188108.
STRINGi9606.ENSP00000074304.

Chemistry databases

SwissLipidsiSLP:000000900.

PTM databases

DEPODiQ96PE3.
iPTMnetiQ96PE3.
PhosphoSitePlusiQ96PE3.

Polymorphism and mutation databases

BioMutaiINPP4A.
DMDMi73920059.

Proteomic databases

EPDiQ96PE3.
MaxQBiQ96PE3.
PaxDbiQ96PE3.
PeptideAtlasiQ96PE3.
PRIDEiQ96PE3.

Protocols and materials databases

DNASUi3631.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000074304; ENSP00000074304; ENSG00000040933. [Q96PE3-1]
ENST00000409016; ENSP00000386704; ENSG00000040933. [Q96PE3-2]
ENST00000409540; ENSP00000387294; ENSG00000040933. [Q96PE3-4]
ENST00000409851; ENSP00000386777; ENSG00000040933. [Q96PE3-3]
ENST00000523221; ENSP00000427722; ENSG00000040933. [Q96PE3-1]
GeneIDi3631.
KEGGihsa:3631.
UCSCiuc002syx.4. human. [Q96PE3-1]

Organism-specific databases

CTDi3631.
DisGeNETi3631.
GeneCardsiINPP4A.
HGNCiHGNC:6074. INPP4A.
HPAiHPA001628.
MIMi600916. gene.
neXtProtiNX_Q96PE3.
OpenTargetsiENSG00000040933.
PharmGKBiPA29882.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4428. Eukaryota.
ENOG410YV83. LUCA.
GeneTreeiENSGT00390000002033.
HOGENOMiHOG000113075.
HOVERGENiHBG081796.
InParanoidiQ96PE3.
KOiK01109.
OMAiTTHCSPP.
OrthoDBiEOG091G02IJ.
PhylomeDBiQ96PE3.
TreeFamiTF325637.

Enzyme and pathway databases

UniPathwayiUPA00944.
BioCyciMetaCyc:HS00551-MONOMER.
ZFISH:HS00551-MONOMER.
BRENDAi3.1.3.66. 2681.
ReactomeiR-HSA-1660499. Synthesis of PIPs at the plasma membrane.
R-HSA-1660516. Synthesis of PIPs at the early endosome membrane.
R-HSA-1855183. Synthesis of IP2, IP, and Ins in the cytosol.

Miscellaneous databases

ChiTaRSiINPP4A. human.
GeneWikiiINPP4A.
GenomeRNAii3631.
PROiQ96PE3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000040933.
CleanExiHS_INPP4A.
ExpressionAtlasiQ96PE3. baseline and differential.
GenevisibleiQ96PE3. HS.

Family and domain databases

Gene3Di2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiINP4A_HUMAN
AccessioniPrimary (citable) accession number: Q96PE3
Secondary accession number(s): O15326
, Q13187, Q53TD8, Q8TC02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.