Q96PB7 (NOE3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Noelin-3 Alternative name(s): Olfactomedin-3 Optimedin | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 478 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Homodimer. Interacts with MYOC By similarity. |
| Subcellular location | Secreted By similarity. |
| Tissue specificity | In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung. Ref.5 |
| Sequence similarities | Contains 1 olfactomedin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Signal |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96PB7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96PB7-2) The sequence of this isoform differs from the canonical sequence as follows: 218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA 236-478: Missing. | ||||||
| Isoform 3 (identifier: Q96PB7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK | ||||||
| Isoform 4 (identifier: Q96PB7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK 218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA 236-478: Missing. | ||||||
| Isoform 5 (identifier: Q96PB7-5) The sequence of this isoform differs from the canonical sequence as follows: 1-95: Missing. | ||||||
| Isoform 6 (identifier: Q96PB7-6) The sequence of this isoform differs from the canonical sequence as follows: 1-95: Missing. 218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA 236-478: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | Potential | ||||||||
| Chain | 24 – 478 | 455 | Noelin-3 | PRO_0000020080 | |||||||
Regions | |||||||||||
| Domain | 218 – 470 | 253 | Olfactomedin-like | ||||||||
| Coiled coil | 77 – 217 | 141 | Potential | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 140 | 1 | Phosphothreonine Ref.7 | ||||||||
| Glycosylation | 33 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 95 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 179 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 299 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 465 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 219 ↔ 401 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 95 | 95 | Missing in isoform 5 and isoform 6. | VSP_003770 | |||||||
| Alternative sequence | 1 – 43 | 43 | MSPPL…TPDTL → MQATSNLLNLLLLSLFAGLD PSK in isoform 3 and isoform 4. | VSP_003769 | |||||||
| Alternative sequence | 218 – 235 | 18 | TCGKL…VKTSG → IDLKKRKEEEKRQQKGEA in isoform 2, isoform 4 and isoform 6. | VSP_003771 | |||||||
| Alternative sequence | 236 – 478 | 243 | Missing in isoform 2, isoform 4 and isoform 6. | VSP_003772 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 88 | 1 | Q → K in AAH22531. Ref.4 | ||||||||
| Sequence conflict | 454 | 1 | Y → C in AAH22531. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "NOE3: a novel olfactomedin/noelin/pancortin homolog identified near an ependymoma-associated translocation breakpoint." Rhodes C.H., Call K.M., Little R., Braunschweiger K., Park J.P. Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6). |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Hippocampus. |
| [5] | "Optimedin: a novel olfactomedin-related protein that interacts with myocilin." Torrado M., Trivedi R., Zinovieva R., Karavanova I., Tomarev S.I. Hum. Mol. Genet. 11:1291-1301(2002) [PubMed: 12019210] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [6] | "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders." Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K. Mol. Vis. 10:304-314(2004) [PubMed: 15123989] [Abstract] Cited for: ALTERNATIVE SPLICING. |
| [7] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-140, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF397392 mRNA. Translation: AAK97473.1. AF397393 mRNA. Translation: AAK97474.1. AF397394 mRNA. Translation: AAK97475.1. AF397395 mRNA. Translation: AAK97476.1. AF397396 mRNA. Translation: AAK97477.1. AF397397 mRNA. Translation: AAK97478.1. AY358722 mRNA. Translation: AAQ89084.1. CH471097 Genomic DNA. Translation: EAW72922.1. BC022531 mRNA. Translation: AAH22531.1. BK001429 Genomic DNA. Translation: DAA01553.1. BK001429 Genomic DNA. Translation: DAA01554.1. BK001429 Genomic DNA. Translation: DAA01555.1. BK001429 Genomic DNA. Translation: DAA01556.1. |
| IPI | IPI00000390. IPI00219998. IPI00219999. IPI00220000. IPI00220001. IPI00220003. |
| RefSeq | NP_477518.2. NM_058170.2. |
| UniGene | Hs.484475. |
3D structure databases | |
| ProteinModelPortal | Q96PB7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96PB7. |
PTM databases | |
| PhosphoSite | Q96PB7. |
Polymorphism databases | |
| DMDM | 20139068. |
Proteomic databases | |
| PRIDE | Q96PB7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338858; ENSP00000345192; ENSG00000118733. |
| GeneID | 118427. |
| KEGG | hsa:118427. |
| UCSC | uc001duf.2. human. uc001dug.2. human. |
Organism-specific databases | |
| CTD | 118427. |
| GeneCards | GC01M102268. |
| HGNC | HGNC:17990. OLFM3. |
| MIM | 607567. gene. |
| neXtProt | NX_Q96PB7. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00560000076789. |
| HOVERGEN | HBG006513. |
| InParanoid | Q96PB7. |
| OMA | SFDMGRV. |
| PhylomeDB | Q96PB7. |
Gene expression databases | |
| ArrayExpress | Q96PB7. |
| Bgee | Q96PB7. |
| CleanEx | HS_OLFM3. |
| Genevestigator | Q96PB7. |
| GermOnline | ENSG00000118733. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR022082. Noelin-1. IPR003112. Olfac-like. [Graphical view] |
| Pfam | PF12308. Noelin-1. 1 hit. PF02191. OLF. 1 hit. [Graphical view] |
| SMART | SM00284. OLF. 1 hit. [Graphical view] |
| PROSITE | PS51132. OLF. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 80270. |
| SOURCE | Search... |
Entry information
| Entry name | NOE3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96PB7 Secondary accession number(s): Q6IMI7 Q96PB6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with