Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Noelin-3

Gene

OLFM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Noelin-3
Alternative name(s):
Olfactomedin-3
Optimedin
Gene namesi
Name:OLFM3
Synonyms:NOE3
ORF Names:UNQ1924/PRO4399
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:17990. OLFM3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Secreted, Synapse

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31917.

Polymorphism and mutation databases

DMDMi20139068.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323Sequence analysisAdd
BLAST
Chaini24 – 478455Noelin-3PRO_0000020080Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi33 – 331N-linked (GlcNAc...)Sequence analysis
Glycosylationi95 – 951N-linked (GlcNAc...)Sequence analysis
Glycosylationi179 – 1791N-linked (GlcNAc...)Sequence analysis
Disulfide bondi219 ↔ 401PROSITE-ProRule annotation
Glycosylationi299 – 2991N-linked (GlcNAc...)Sequence analysis
Glycosylationi465 – 4651N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ96PB7.
PRIDEiQ96PB7.

PTM databases

iPTMnetiQ96PB7.
PhosphoSiteiQ96PB7.

Expressioni

Tissue specificityi

In the eye, expressed in trabecular meshwork and neural retina; in non-ocular tissues, expressed in brain and lung.1 Publication

Gene expression databases

BgeeiQ96PB7.
CleanExiHS_OLFM3.
ExpressionAtlasiQ96PB7. baseline and differential.
GenevisibleiQ96PB7. HS.

Organism-specific databases

HPAiHPA050297.

Interactioni

Subunit structurei

Peripherally associated with AMPAR complex. AMPAR complex consists of an inner core made of 4 pore-forming GluA/GRIA proteins (GRIA1, GRIA2, GRIA3 and GRIA4) and 4 major auxiliary subunits arranged in a twofold symmetry. One of the two pairs of distinct binding sites is occupied either by CNIH2, CNIH3 or CACNG2, CACNG3. The other harbors CACNG2, CACNG3, CACNG4, CACNG8 or GSG1L. This inner core of AMPAR complex is complemented by outer core constituents binding directly to the GluA/GRIA proteins at sites distinct from the interaction sites of the inner core constituents. Outer core constituents include at least PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L and NRN1. The proteins of the inner and outer core serve as a platform for other, more peripherally associated AMPAR constituents, including OLFM3. Alone or in combination, these auxiliary subunits control the gating and pharmacology of the AMPAR complex and profoundly impact their biogenesis and protein processing. Homodimer. Interacts with MYOC (By similarity). Interacts with OLFM2 (PubMed:21228389).By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ADAMTSL4Q6UY14-33EBI-10292253,EBI-10173507
GLRX3O760033EBI-10292253,EBI-374781
STUB1Q9UNE73EBI-10292253,EBI-357085

Protein-protein interaction databases

BioGridi125601. 10 interactions.
IntActiQ96PB7. 3 interactions.
STRINGi9606.ENSP00000359121.

Structurei

3D structure databases

ProteinModelPortaliQ96PB7.
SMRiQ96PB7. Positions 217-472.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini218 – 470253Olfactomedin-likePROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili77 – 217141Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 olfactomedin-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Signal

Phylogenomic databases

eggNOGiENOG410INP6. Eukaryota.
ENOG410ZVS0. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG061751.
InParanoidiQ96PB7.
OMAiIKYSFDT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ96PB7.
TreeFamiTF315964.

Family and domain databases

InterProiIPR031216. Noelin-3.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF36. PTHR23192:SF36. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 3 hits.
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96PB7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSPPLLKLGA VLSTMAMISN WMSQTLPSLV GLNTTRLSTP DTLTQISPKE
60 70 80 90 100
GWQVYSSAQD PDGRCICTVV APEQNLCSRD AKSRQLRQLL EKVQNMSQSI
110 120 130 140 150
EVLNLRTQRD FQYVLKMETQ MKGLKAKFRQ IEDDRKTLMT KHFQELKEKM
160 170 180 190 200
DELLPLIPVL EQYKTDAKLI TQFKEEIRNL SAVLTGIQEE IGAYDYEELH
210 220 230 240 250
QRVLSLETRL RDCMKKLTCG KLMKITGPVT VKTSGTRFGA WMTDPLASEK
260 270 280 290 300
NNRVWYMDSY TNNKIVREYK SIADFVSGAE SRTYNLPFKW AGTNHVVYNG
310 320 330 340 350
SLYFNKYQSN IIIKYSFDMG RVLAQRSLEY AGFHNVYPYT WGGFSDIDLM
360 370 380 390 400
ADEIGLWAVY ATNQNAGNIV ISQLNQDTLE VMKSWSTGYP KRSAGESFMI
410 420 430 440 450
CGTLYVTNSH LTGAKVYYSY STKTSTYEYT DIPFHNQYFH ISMLDYNARD
460 470
RALYAWNNGH QVLFNVTLFH IIKTEDDT
Length:478
Mass (Da):54,930
Last modified:December 1, 2001 - v1
Checksum:i02EAAF58741489E5
GO
Isoform 2 (identifier: Q96PB7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:235
Mass (Da):27,218
Checksum:iB27366B01FB042F5
GO
Isoform 3 (identifier: Q96PB7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK

Show »
Length:458
Mass (Da):52,801
Checksum:i0A7C25D9E84755FC
GO
Isoform 4 (identifier: Q96PB7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MSPPLLKLGAVLSTMAMISNWMSQTLPSLVGLNTTRLSTPDTL → MQATSNLLNLLLLSLFAGLDPSK
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:215
Mass (Da):25,089
Checksum:i5B898299AFC1837E
GO
Isoform 5 (identifier: Q96PB7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.

Show »
Length:383
Mass (Da):44,502
Checksum:i895CD21DBC660834
GO
Isoform 6 (identifier: Q96PB7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-95: Missing.
     218-235: TCGKLMKITGPVTVKTSG → IDLKKRKEEEKRQQKGEA
     236-478: Missing.

Show »
Length:140
Mass (Da):16,790
Checksum:i504964995B04DF3C
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881Q → K in AAH22531 (PubMed:15489334).Curated
Sequence conflicti454 – 4541Y → C in AAH22531 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9595Missing in isoform 5 and isoform 6. 1 PublicationVSP_003770Add
BLAST
Alternative sequencei1 – 4343MSPPL…TPDTL → MQATSNLLNLLLLSLFAGLD PSK in isoform 3 and isoform 4. 2 PublicationsVSP_003769Add
BLAST
Alternative sequencei218 – 23518TCGKL…VKTSG → IDLKKRKEEEKRQQKGEA in isoform 2, isoform 4 and isoform 6. 1 PublicationVSP_003771Add
BLAST
Alternative sequencei236 – 478243Missing in isoform 2, isoform 4 and isoform 6. 1 PublicationVSP_003772Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF397392 mRNA. Translation: AAK97473.1.
AF397393 mRNA. Translation: AAK97474.1.
AF397394 mRNA. Translation: AAK97475.1.
AF397395 mRNA. Translation: AAK97476.1.
AF397396 mRNA. Translation: AAK97477.1.
AF397397 mRNA. Translation: AAK97478.1.
AY358722 mRNA. Translation: AAQ89084.1.
AK095724 mRNA. Translation: BAG53115.1.
AL359760, AL356280 Genomic DNA. Translation: CAI15682.1.
AL356280, AL359760 Genomic DNA. Translation: CAI16873.1.
CH471097 Genomic DNA. Translation: EAW72922.1.
BC022531 mRNA. Translation: AAH22531.1.
BK001429 Genomic DNA. Translation: DAA01551.1.
BK001429 Genomic DNA. Translation: DAA01553.1.
BK001429 Genomic DNA. Translation: DAA01554.1.
BK001429 Genomic DNA. Translation: DAA01555.1.
BK001429 Genomic DNA. Translation: DAA01556.1.
CCDSiCCDS30781.1. [Q96PB7-3]
CCDS72832.1. [Q96PB7-1]
RefSeqiNP_001275750.1. NM_001288821.1. [Q96PB7-1]
NP_001275752.1. NM_001288823.1. [Q96PB7-5]
NP_477518.2. NM_058170.3. [Q96PB7-3]
XP_005270491.1. XM_005270434.3. [Q96PB7-5]
UniGeneiHs.484475.

Genome annotation databases

EnsembliENST00000338858; ENSP00000345192; ENSG00000118733. [Q96PB7-1]
ENST00000370103; ENSP00000359121; ENSG00000118733. [Q96PB7-3]
ENST00000536598; ENSP00000443471; ENSG00000118733. [Q96PB7-6]
GeneIDi118427.
KEGGihsa:118427.
UCSCiuc001duf.4. human. [Q96PB7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF397392 mRNA. Translation: AAK97473.1.
AF397393 mRNA. Translation: AAK97474.1.
AF397394 mRNA. Translation: AAK97475.1.
AF397395 mRNA. Translation: AAK97476.1.
AF397396 mRNA. Translation: AAK97477.1.
AF397397 mRNA. Translation: AAK97478.1.
AY358722 mRNA. Translation: AAQ89084.1.
AK095724 mRNA. Translation: BAG53115.1.
AL359760, AL356280 Genomic DNA. Translation: CAI15682.1.
AL356280, AL359760 Genomic DNA. Translation: CAI16873.1.
CH471097 Genomic DNA. Translation: EAW72922.1.
BC022531 mRNA. Translation: AAH22531.1.
BK001429 Genomic DNA. Translation: DAA01551.1.
BK001429 Genomic DNA. Translation: DAA01553.1.
BK001429 Genomic DNA. Translation: DAA01554.1.
BK001429 Genomic DNA. Translation: DAA01555.1.
BK001429 Genomic DNA. Translation: DAA01556.1.
CCDSiCCDS30781.1. [Q96PB7-3]
CCDS72832.1. [Q96PB7-1]
RefSeqiNP_001275750.1. NM_001288821.1. [Q96PB7-1]
NP_001275752.1. NM_001288823.1. [Q96PB7-5]
NP_477518.2. NM_058170.3. [Q96PB7-3]
XP_005270491.1. XM_005270434.3. [Q96PB7-5]
UniGeneiHs.484475.

3D structure databases

ProteinModelPortaliQ96PB7.
SMRiQ96PB7. Positions 217-472.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125601. 10 interactions.
IntActiQ96PB7. 3 interactions.
STRINGi9606.ENSP00000359121.

PTM databases

iPTMnetiQ96PB7.
PhosphoSiteiQ96PB7.

Polymorphism and mutation databases

DMDMi20139068.

Proteomic databases

PaxDbiQ96PB7.
PRIDEiQ96PB7.

Protocols and materials databases

DNASUi118427.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338858; ENSP00000345192; ENSG00000118733. [Q96PB7-1]
ENST00000370103; ENSP00000359121; ENSG00000118733. [Q96PB7-3]
ENST00000536598; ENSP00000443471; ENSG00000118733. [Q96PB7-6]
GeneIDi118427.
KEGGihsa:118427.
UCSCiuc001duf.4. human. [Q96PB7-1]

Organism-specific databases

CTDi118427.
GeneCardsiOLFM3.
H-InvDBHIX0000823.
HGNCiHGNC:17990. OLFM3.
HPAiHPA050297.
MIMi607567. gene.
neXtProtiNX_Q96PB7.
PharmGKBiPA31917.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410INP6. Eukaryota.
ENOG410ZVS0. LUCA.
GeneTreeiENSGT00760000119005.
HOGENOMiHOG000232069.
HOVERGENiHBG061751.
InParanoidiQ96PB7.
OMAiIKYSFDT.
OrthoDBiEOG75F4CZ.
PhylomeDBiQ96PB7.
TreeFamiTF315964.

Miscellaneous databases

ChiTaRSiOLFM3. human.
GeneWikiiOLFM3.
GenomeRNAii118427.
NextBioi80270.
PROiQ96PB7.
SOURCEiSearch...

Gene expression databases

BgeeiQ96PB7.
CleanExiHS_OLFM3.
ExpressionAtlasiQ96PB7. baseline and differential.
GenevisibleiQ96PB7. HS.

Family and domain databases

InterProiIPR031216. Noelin-3.
IPR022082. Noelin_dom.
IPR003112. Olfac-like_dom.
IPR011044. Quino_amine_DH_bsu.
[Graphical view]
PANTHERiPTHR23192:SF36. PTHR23192:SF36. 1 hit.
PfamiPF12308. Noelin-1. 1 hit.
PF02191. OLF. 1 hit.
[Graphical view]
SMARTiSM00284. OLF. 1 hit.
[Graphical view]
SUPFAMiSSF50969. SSF50969. 3 hits.
PROSITEiPS51132. OLF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "NOE3: a novel olfactomedin/noelin/pancortin homolog identified near an ependymoma-associated translocation breakpoint."
    Rhodes C.H., Call K.M., Little R., Braunschweiger K., Park J.P.
    Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5 AND 6).
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Brain.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Hippocampus.
  7. "Optimedin: a novel olfactomedin-related protein that interacts with myocilin."
    Torrado M., Trivedi R., Zinovieva R., Karavanova I., Tomarev S.I.
    Hum. Mol. Genet. 11:1291-1301(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "Bioinformatic approaches for identification and characterization of olfactomedin related genes with a potential role in pathogenesis of ocular disorders."
    Mukhopadhyay A., Talukdar S., Bhattacharjee A., Ray K.
    Mol. Vis. 10:304-314(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: ALTERNATIVE SPLICING.
  9. "Olfactomedin 2: expression in the eye and interaction with other olfactomedin domain-containing proteins."
    Sultana A., Nakaya N., Senatorov V.V., Tomarev S.I.
    Invest. Ophthalmol. Vis. Sci. 52:2584-2592(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH OLFM2.

Entry informationi

Entry nameiNOE3_HUMAN
AccessioniPrimary (citable) accession number: Q96PB7
Secondary accession number(s): Q5T3V6
, Q6IMI7, Q6IMI8, Q6IMI9, Q6IMJ1, Q8TBG1, Q96PB2, Q96PB3, Q96PB4, Q96PB5, Q96PB6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: December 1, 2001
Last modified: March 16, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.