Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96P16

- RPR1A_HUMAN

UniProt

Q96P16 - RPR1A_HUMAN

Protein

Regulation of nuclear pre-mRNA domain-containing protein 1A

Gene

RPRD1A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.1 Publication

    GO - Biological processi

    1. dephosphorylation of RNA polymerase II C-terminal domain Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Regulation of nuclear pre-mRNA domain-containing protein 1A
    Alternative name(s):
    Cyclin-dependent kinase inhibitor 2B-related protein
    p15INK4B-related protein
    Gene namesi
    Name:RPRD1A
    Synonyms:P15RS
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 18

    Organism-specific databases

    HGNCiHGNC:25560. RPRD1A.

    Subcellular locationi

    GO - Cellular componenti

    1. DNA-directed RNA polymerase II, holoenzyme Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162402042.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed2 Publications
    Chaini2 – 312311Regulation of nuclear pre-mRNA domain-containing protein 1APRO_0000311344Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylserine2 Publications

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ96P16.
    PaxDbiQ96P16.
    PRIDEiQ96P16.

    PTM databases

    PhosphoSiteiQ96P16.

    Expressioni

    Inductioni

    Up-regulated in cells overexpressing CDKN2B.1 Publication

    Gene expression databases

    ArrayExpressiQ96P16.
    BgeeiQ96P16.
    CleanExiHS_RPRD1A.
    GenevestigatoriQ96P16.

    Organism-specific databases

    HPAiHPA040602.

    Interactioni

    Subunit structurei

    Associates with the RNA polymerase II complex.1 Publication

    Protein-protein interaction databases

    BioGridi120494. 21 interactions.
    IntActiQ96P16. 7 interactions.
    MINTiMINT-4537177.
    STRINGi9606.ENSP00000349955.

    Structurei

    Secondary structure

    1
    312
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi6 – 1510
    Helixi20 – 3213
    Helixi34 – 363
    Helixi37 – 5014
    Helixi53 – 553
    Helixi56 – 7015
    Turni71 – 733
    Helixi76 – 9520
    Helixi98 – 11316
    Helixi119 – 13012

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    4JXTX-ray1.90A1-137[»]
    4NACX-ray2.00A/B1-131[»]
    ProteinModelPortaliQ96P16.
    SMRiQ96P16. Positions 2-131, 163-290.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini2 – 133132CIDPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili244 – 28643Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the UPF0400 (RTT103) family.Curated
    Contains 1 CID domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG291577.
    HOGENOMiHOG000007456.
    HOVERGENiHBG051177.
    InParanoidiQ96P16.
    OMAiALTETHE.
    PhylomeDBiQ96P16.
    TreeFamiTF320926.

    Family and domain databases

    Gene3Di1.25.40.90. 1 hit.
    InterProiIPR006569. CID_dom.
    IPR008942. ENTH_VHS.
    IPR006903. RNA_pol_II-bd.
    [Graphical view]
    PfamiPF04818. CTD_bind. 1 hit.
    [Graphical view]
    SMARTiSM00582. RPR. 1 hit.
    [Graphical view]
    SUPFAMiSSF48464. SSF48464. 1 hit.
    PROSITEiPS51391. CID. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96P16-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSAFSEAALE KKLSELSNSQ QSVQTLSLWL IHHRKHSRPI VTVWERELRK    50
    AKPNRKLTFL YLANDVIQNS KRKGPEFTKD FAPVIVEAFK HVSSETDESC 100
    KKHLGRVLSI WEERSVYEND VLEQLKQALY GDKKPRKRTY EQIKVDENEN 150
    CSSLGSPSEP PQTLDLVRAL QDLENAASGD AAVHQRIASL PVEVQEVSLL 200
    DKITDKESGE RLSKMVEDAC MLLADYNGRL AAEIDDRKQL TRMLADFLRC 250
    QKEALAEKEH KLEEYKRKLA RVSLVRKELR SRIQSLPDLS RLPNVTGSHM 300
    HLPFAGDIYS ED 312
    Length:312
    Mass (Da):35,720
    Last modified:December 1, 2001 - v1
    Checksum:i61785281F31CB328
    GO
    Isoform 2 (identifier: Q96P16-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA → MRNSNWRFCQTGIYS

    Show »
    Length:276
    Mass (Da):31,625
    Checksum:i09748C553C326E55
    GO

    Sequence cautioni

    The sequence AAH10136.1 differs from that shown. Reason: Probable cloning artifact.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti193 – 1931E → D in BAA91736. (PubMed:14702039)Curated
    Sequence conflicti234 – 2341I → V in BAA91736. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti21 – 211Q → H in a breast cancer sample; somatic mutation. 1 Publication
    VAR_037229

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5151MSAFS…ELRKA → MRNSNWRFCQTGIYS in isoform 2. 2 PublicationsVSP_029531Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF419845 mRNA. Translation: AAL15972.1.
    AK001518 mRNA. Translation: BAA91736.1.
    AK292907 mRNA. Translation: BAF85596.1.
    AK314569 mRNA. Translation: BAG37150.1.
    CH471088 Genomic DNA. Translation: EAX01365.1.
    CH471088 Genomic DNA. Translation: EAX01366.1.
    CH471088 Genomic DNA. Translation: EAX01367.1.
    BC000225 mRNA. Translation: AAH00225.2.
    BC010136 mRNA. Translation: AAH10136.1. Sequence problems.
    CCDSiCCDS11917.1. [Q96P16-1]
    RefSeqiNP_060640.2. NM_018170.3. [Q96P16-1]
    XP_005258350.1. XM_005258293.1.
    XP_005258351.1. XM_005258294.1. [Q96P16-3]
    UniGeneiHs.464912.

    Genome annotation databases

    EnsembliENST00000357384; ENSP00000349955; ENSG00000141425. [Q96P16-1]
    ENST00000399022; ENSP00000381984; ENSG00000141425. [Q96P16-1]
    ENST00000588737; ENSP00000465444; ENSG00000141425. [Q96P16-3]
    ENST00000589050; ENSP00000468209; ENSG00000141425.
    ENST00000590898; ENSP00000467991; ENSG00000141425. [Q96P16-3]
    GeneIDi55197.
    KEGGihsa:55197.
    UCSCiuc002kze.1. human. [Q96P16-3]
    uc002kzg.3. human. [Q96P16-1]

    Polymorphism databases

    DMDMi74717048.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF419845 mRNA. Translation: AAL15972.1 .
    AK001518 mRNA. Translation: BAA91736.1 .
    AK292907 mRNA. Translation: BAF85596.1 .
    AK314569 mRNA. Translation: BAG37150.1 .
    CH471088 Genomic DNA. Translation: EAX01365.1 .
    CH471088 Genomic DNA. Translation: EAX01366.1 .
    CH471088 Genomic DNA. Translation: EAX01367.1 .
    BC000225 mRNA. Translation: AAH00225.2 .
    BC010136 mRNA. Translation: AAH10136.1 . Sequence problems.
    CCDSi CCDS11917.1. [Q96P16-1 ]
    RefSeqi NP_060640.2. NM_018170.3. [Q96P16-1 ]
    XP_005258350.1. XM_005258293.1.
    XP_005258351.1. XM_005258294.1. [Q96P16-3 ]
    UniGenei Hs.464912.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    4JXT X-ray 1.90 A 1-137 [» ]
    4NAC X-ray 2.00 A/B 1-131 [» ]
    ProteinModelPortali Q96P16.
    SMRi Q96P16. Positions 2-131, 163-290.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120494. 21 interactions.
    IntActi Q96P16. 7 interactions.
    MINTi MINT-4537177.
    STRINGi 9606.ENSP00000349955.

    PTM databases

    PhosphoSitei Q96P16.

    Polymorphism databases

    DMDMi 74717048.

    Proteomic databases

    MaxQBi Q96P16.
    PaxDbi Q96P16.
    PRIDEi Q96P16.

    Protocols and materials databases

    DNASUi 55197.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357384 ; ENSP00000349955 ; ENSG00000141425 . [Q96P16-1 ]
    ENST00000399022 ; ENSP00000381984 ; ENSG00000141425 . [Q96P16-1 ]
    ENST00000588737 ; ENSP00000465444 ; ENSG00000141425 . [Q96P16-3 ]
    ENST00000589050 ; ENSP00000468209 ; ENSG00000141425 .
    ENST00000590898 ; ENSP00000467991 ; ENSG00000141425 . [Q96P16-3 ]
    GeneIDi 55197.
    KEGGi hsa:55197.
    UCSCi uc002kze.1. human. [Q96P16-3 ]
    uc002kzg.3. human. [Q96P16-1 ]

    Organism-specific databases

    CTDi 55197.
    GeneCardsi GC18M033569.
    H-InvDB HIX0014404.
    HGNCi HGNC:25560. RPRD1A.
    HPAi HPA040602.
    MIMi 610347. gene.
    neXtProti NX_Q96P16.
    PharmGKBi PA162402042.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG291577.
    HOGENOMi HOG000007456.
    HOVERGENi HBG051177.
    InParanoidi Q96P16.
    OMAi ALTETHE.
    PhylomeDBi Q96P16.
    TreeFami TF320926.

    Miscellaneous databases

    ChiTaRSi RPRD1A. human.
    GenomeRNAii 55197.
    NextBioi 59071.
    PROi Q96P16.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96P16.
    Bgeei Q96P16.
    CleanExi HS_RPRD1A.
    Genevestigatori Q96P16.

    Family and domain databases

    Gene3Di 1.25.40.90. 1 hit.
    InterProi IPR006569. CID_dom.
    IPR008942. ENTH_VHS.
    IPR006903. RNA_pol_II-bd.
    [Graphical view ]
    Pfami PF04818. CTD_bind. 1 hit.
    [Graphical view ]
    SMARTi SM00582. RPR. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48464. SSF48464. 1 hit.
    PROSITEi PS51391. CID. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification and characterization of P15RS, a novel P15(INK4b) related gene on G1/S progression."
      Liu J., Liu H., Zhang X., Gao P., Wang J., Hu Z.
      Biochem. Biophys. Res. Commun. 299:880-885(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION, INDUCTION.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Placenta, Teratocarcinoma and Trachea.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-263 (ISOFORM 1).
      Tissue: Eye and Muscle.
    5. Bienvenut W.V., Bilsland A.E., Keith W.N.
      Submitted (JAN-2010) to UniProtKB
      Cited for: PROTEIN SEQUENCE OF 2-12; 107-114; 169-186; 230-237; 243-249 AND 283-291, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY.
      Tissue: Colon carcinoma.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B."
      Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F.
      Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX, FUNCTION.
    9. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-21.

    Entry informationi

    Entry nameiRPR1A_HUMAN
    AccessioniPrimary (citable) accession number: Q96P16
    Secondary accession number(s): A8KA42
    , B2RBA3, Q7Z5G8, Q96FY9, Q9NVL4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 85 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 18
      Human chromosome 18: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families
    7. Uncharacterized protein families (UPF)
      List of uncharacterized protein family (UPF) entries

    External Data

    Dasty 3