Q96P16 (RPR1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Regulation of nuclear pre-mRNA domain-containing protein 1A Alternative name(s): Cyclin-dependent kinase inhibitor 2B-related protein p15INK4B-related protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 312 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle. Ref.1 Ref.7 |
| Subunit structure | Associates with the RNA polymerase II complex. Ref.7 |
| Induction | Up-regulated in cells overexpressing CDKN2B. Ref.1 |
| Sequence similarities | Belongs to the UPF0400 (RTT103) family. Contains 1 CID domain. |
| Sequence caution | The sequence AAH10136.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Acetylation |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | dephosphorylation of RNA polymerase II C-terminal domain Inferred from mutant phenotype Ref.7. Source: UniProtKB |
| Cellular_component | DNA-directed RNA polymerase II, holoenzyme Inferred from direct assay Ref.7. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96P16-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96P16-3) The sequence of this isoform differs from the canonical sequence as follows: 1-51: MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA → MRNSNWRFCQTGIYS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.5 | ||||||
| Chain | 2 – 312 | 311 | Regulation of nuclear pre-mRNA domain-containing protein 1A | PRO_0000311344 | |||||
Regions | |||||||||
| Domain | 2 – 133 | 132 | CID | ||||||
| Coiled coil | 244 – 286 | 43 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylserine Ref.5 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 51 | 51 | MSAFS…ELRKA → MRNSNWRFCQTGIYS in isoform 2. | VSP_029531 | |||||
| Natural variant | 21 | 1 | Q → H in a breast cancer sample; somatic mutation. Ref.8 | VAR_037229 | |||||
Experimental info | |||||||||
| Sequence conflict | 193 | 1 | E → D in BAA91736. Ref.2 | ||||||
| Sequence conflict | 234 | 1 | I → V in BAA91736. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and characterization of P15RS, a novel P15(INK4b) related gene on G1/S progression." Liu J., Liu H., Zhang X., Gao P., Wang J., Hu Z. Biochem. Biophys. Res. Commun. 299:880-885(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION, INDUCTION. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta, Teratocarcinoma and Trachea. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-263 (ISOFORM 1). Tissue: Eye and Muscle. |
| [5] | Bienvenut W.V., Bilsland A.E., Keith W.N. Submitted (JAN-2010) to UniProtKB Cited for: PROTEIN SEQUENCE OF 2-12; 107-114; 169-186; 230-237; 243-249 AND 283-291, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT SER-2, MASS SPECTROMETRY. Tissue: Colon carcinoma. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B." Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F. Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX, FUNCTION. |
| [8] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-21. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF419845 mRNA. Translation: AAL15972.1. AK001518 mRNA. Translation: BAA91736.1. AK292907 mRNA. Translation: BAF85596.1. AK314569 mRNA. Translation: BAG37150.1. CH471088 Genomic DNA. Translation: EAX01365.1. CH471088 Genomic DNA. Translation: EAX01366.1. CH471088 Genomic DNA. Translation: EAX01367.1. BC000225 mRNA. Translation: AAH00225.2. BC010136 mRNA. Translation: AAH10136.1. Sequence problems. |
| IPI | IPI00062336. IPI00102425. IPI00385260. |
| RefSeq | NP_060640.2. NM_018170.3. |
| UniGene | Hs.464912. |
3D structure databases | |
| ProteinModelPortal | Q96P16. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96P16. 5 interactions. |
| STRING | 9606.ENSP00000349955. |
PTM databases | |
| PhosphoSite | Q96P16. |
Polymorphism databases | |
| DMDM | 74717048. |
Proteomic databases | |
| PaxDb | Q96P16. |
| PRIDE | Q96P16. |
Protocols and materials databases | |
| DNASU | 55197. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000319040; ENSP00000314602; ENSG00000141425. ENST00000337059; ENSP00000337476; ENSG00000141425. ENST00000357384; ENSP00000349955; ENSG00000141425. ENST00000399022; ENSP00000381984; ENSG00000141425. ENST00000588737; ENSP00000465444; ENSG00000141425. ENST00000589050; ENSP00000468209; ENSG00000141425. ENST00000590898; ENSP00000467991; ENSG00000141425. |
| GeneID | 55197. |
| KEGG | hsa:55197. |
| UCSC | uc002kze.1. human. uc002kzg.3. human. uc010dmx.3. human. |
Organism-specific databases | |
| CTD | 55197. |
| GeneCards | GC18M033569. |
| H-InvDB | HIX0014404. |
| HGNC | HGNC:25560. RPRD1A. |
| HPA | HPA040602. |
| MIM | 610347. gene. |
| neXtProt | NX_Q96P16. |
| PharmGKB | PA162402042. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG291577. |
| HOGENOM | HOG000007456. |
| HOVERGEN | HBG051177. |
| InParanoid | Q96P16. |
| OMA | SDFLRCQ. |
| OrthoDB | EOG4F4SBP. |
| PhylomeDB | Q96P16. |
Gene expression databases | |
| Bgee | Q96P16. |
| CleanEx | HS_RPRD1A. |
| Genevestigator | Q96P16. |
Family and domain databases | |
| Gene3D | 1.25.40.90. 1 hit. |
| InterPro | IPR006569. CID_dom. IPR008942. ENTH_VHS. IPR006903. RNA_pol_II-bd. [Graphical view] |
| Pfam | PF04818. CTD_bind. 1 hit. [Graphical view] |
| SMART | SM00582. RPR. 1 hit. [Graphical view] |
| SUPFAM | SSF48464. ENTH_VHS. 1 hit. |
| PROSITE | PS51391. CID. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RPRD1A. human. |
| GenomeRNAi | 55197. |
| NextBio | 59071. |
| SOURCE | Search... |
Entry information
| Entry name | RPR1A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96P16 Secondary accession number(s): A8KA42 Q9NVL4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
