Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96P16 (RPR1A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (7) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Regulation of nuclear pre-mRNA domain-containing protein 1A
Alternative name(s):
Cyclin-dependent kinase inhibitor 2B-related protein
p15INK4B-related protein
Gene names
Name:RPRD1A
Synonyms:P15RS
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length312 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle. Ref.1 Ref.8

Subunit structure

Associates with the RNA polymerase II complex. Ref.8

Induction

Up-regulated in cells overexpressing CDKN2B. Ref.1

Sequence similarities

Belongs to the UPF0400 (RTT103) family.

Contains 1 CID domain.

Sequence caution

The sequence AAH10136.1 differs from that shown. Reason: Probable cloning artifact.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96P16-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96P16-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA → MRNSNWRFCQTGIYS

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed Ref.5
Chain2 – 312311Regulation of nuclear pre-mRNA domain-containing protein 1A
PRO_0000311344

Regions

Domain2 – 133132CID
Coiled coil244 – 28643 Potential

Amino acid modifications

Modified residue21N-acetylserine Ref.5 Ref.6

Natural variations

Alternative sequence1 – 5151MSAFS…ELRKA → MRNSNWRFCQTGIYS in isoform 2.
VSP_029531
Natural variant211Q → H in a breast cancer sample; somatic mutation. Ref.9
VAR_037229

Experimental info

Sequence conflict1931E → D in BAA91736. Ref.2
Sequence conflict2341I → V in BAA91736. Ref.2

Secondary structure

.................. 312
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 61785281F31CB328

FASTA31235,720
        10         20         30         40         50         60 
MSAFSEAALE KKLSELSNSQ QSVQTLSLWL IHHRKHSRPI VTVWERELRK AKPNRKLTFL 

        70         80         90        100        110        120 
YLANDVIQNS KRKGPEFTKD FAPVIVEAFK HVSSETDESC KKHLGRVLSI WEERSVYEND 

       130        140        150        160        170        180 
VLEQLKQALY GDKKPRKRTY EQIKVDENEN CSSLGSPSEP PQTLDLVRAL QDLENAASGD 

       190        200        210        220        230        240 
AAVHQRIASL PVEVQEVSLL DKITDKESGE RLSKMVEDAC MLLADYNGRL AAEIDDRKQL 

       250        260        270        280        290        300 
TRMLADFLRC QKEALAEKEH KLEEYKRKLA RVSLVRKELR SRIQSLPDLS RLPNVTGSHM 

       310 
HLPFAGDIYS ED 

« Hide

Isoform 2 [UniParc].

Checksum: 09748C553C326E55
Show »

FASTA27631,625

References

« Hide 'large scale' references
[1]"Identification and characterization of P15RS, a novel P15(INK4b) related gene on G1/S progression."
Liu J., Liu H., Zhang X., Gao P., Wang J., Hu Z.
Biochem. Biophys. Res. Commun. 299:880-885(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION, INDUCTION.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Placenta, Teratocarcinoma and Trachea.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-263 (ISOFORM 1).
Tissue: Eye and Muscle.
[5]Bienvenut W.V., Bilsland A.E., Keith W.N.
Submitted (JAN-2010) to UniProtKB
Cited for: PROTEIN SEQUENCE OF 2-12; 107-114; 169-186; 230-237; 243-249 AND 283-291, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY.
Tissue: Colon carcinoma.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[8]"Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B."
Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F.
Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX, FUNCTION.
[9]"The consensus coding sequences of human breast and colorectal cancers."
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. expand/collapse author list , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.
Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-21.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF419845 mRNA. Translation: AAL15972.1.
AK001518 mRNA. Translation: BAA91736.1.
AK292907 mRNA. Translation: BAF85596.1.
AK314569 mRNA. Translation: BAG37150.1.
CH471088 Genomic DNA. Translation: EAX01365.1.
CH471088 Genomic DNA. Translation: EAX01366.1.
CH471088 Genomic DNA. Translation: EAX01367.1.
BC000225 mRNA. Translation: AAH00225.2.
BC010136 mRNA. Translation: AAH10136.1. Sequence problems.
CCDSCCDS11917.1. [Q96P16-1]
RefSeqNP_060640.2. NM_018170.3. [Q96P16-1]
XP_005258350.1. XM_005258293.1.
XP_005258351.1. XM_005258294.1. [Q96P16-3]
UniGeneHs.464912.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
4JXTX-ray1.90A1-137[»]
4NACX-ray2.00A/B1-131[»]
ProteinModelPortalQ96P16.
SMRQ96P16. Positions 2-131, 163-290.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120494. 21 interactions.
IntActQ96P16. 7 interactions.
MINTMINT-4537177.
STRING9606.ENSP00000349955.

PTM databases

PhosphoSiteQ96P16.

Polymorphism databases

DMDM74717048.

Proteomic databases

MaxQBQ96P16.
PaxDbQ96P16.
PRIDEQ96P16.

Protocols and materials databases

DNASU55197.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000319040; ENSP00000314602; ENSG00000141425.
ENST00000337059; ENSP00000337476; ENSG00000141425. [Q96P16-3]
ENST00000357384; ENSP00000349955; ENSG00000141425. [Q96P16-1]
ENST00000399022; ENSP00000381984; ENSG00000141425. [Q96P16-1]
ENST00000588737; ENSP00000465444; ENSG00000141425. [Q96P16-3]
ENST00000589050; ENSP00000468209; ENSG00000141425.
ENST00000590898; ENSP00000467991; ENSG00000141425. [Q96P16-3]
GeneID55197.
KEGGhsa:55197.
UCSCuc002kze.1. human. [Q96P16-3]
uc002kzg.3. human. [Q96P16-1]

Organism-specific databases

CTD55197.
GeneCardsGC18M033569.
H-InvDBHIX0014404.
HGNCHGNC:25560. RPRD1A.
HPAHPA040602.
MIM610347. gene.
neXtProtNX_Q96P16.
PharmGKBPA162402042.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG291577.
HOGENOMHOG000007456.
HOVERGENHBG051177.
InParanoidQ96P16.
OMAALTETHE.
PhylomeDBQ96P16.
TreeFamTF320926.

Gene expression databases

ArrayExpressQ96P16.
BgeeQ96P16.
CleanExHS_RPRD1A.
GenevestigatorQ96P16.

Family and domain databases

Gene3D1.25.40.90. 1 hit.
InterProIPR006569. CID_dom.
IPR008942. ENTH_VHS.
IPR006903. RNA_pol_II-bd.
[Graphical view]
PfamPF04818. CTD_bind. 1 hit.
[Graphical view]
SMARTSM00582. RPR. 1 hit.
[Graphical view]
SUPFAMSSF48464. SSF48464. 1 hit.
PROSITEPS51391. CID. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSRPRD1A. human.
GenomeRNAi55197.
NextBio59071.
PROQ96P16.
SOURCESearch...

Entry information

Entry nameRPR1A_HUMAN
AccessionPrimary (citable) accession number: Q96P16
Secondary accession number(s): A8KA42 expand/collapse secondary AC list , B2RBA3, Q7Z5G8, Q96FY9, Q9NVL4
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Uncharacterized protein families (UPF)

List of uncharacterized protein family (UPF) entries

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 18

Human chromosome 18: entries, gene names and cross-references to MIM