SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96P16

- RPR1A_HUMAN

UniProt

Q96P16 - RPR1A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Regulation of nuclear pre-mRNA domain-containing protein 1A
Gene
RPRD1A, P15RS
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.2 Publications

GO - Biological processi

  1. dephosphorylation of RNA polymerase II C-terminal domain Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Regulation of nuclear pre-mRNA domain-containing protein 1A
Alternative name(s):
Cyclin-dependent kinase inhibitor 2B-related protein
p15INK4B-related protein
Gene namesi
Name:RPRD1A
Synonyms:P15RS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 18

Organism-specific databases

HGNCiHGNC:25560. RPRD1A.

Subcellular locationi

GO - Cellular componenti

  1. DNA-directed RNA polymerase II, holoenzyme Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162402042.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 312311Regulation of nuclear pre-mRNA domain-containing protein 1A
PRO_0000311344Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserine2 Publications

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ96P16.
PaxDbiQ96P16.
PRIDEiQ96P16.

PTM databases

PhosphoSiteiQ96P16.

Expressioni

Inductioni

Up-regulated in cells overexpressing CDKN2B.1 Publication

Gene expression databases

ArrayExpressiQ96P16.
BgeeiQ96P16.
CleanExiHS_RPRD1A.
GenevestigatoriQ96P16.

Organism-specific databases

HPAiHPA040602.

Interactioni

Subunit structurei

Associates with the RNA polymerase II complex.1 Publication

Protein-protein interaction databases

BioGridi120494. 21 interactions.
IntActiQ96P16. 7 interactions.
MINTiMINT-4537177.
STRINGi9606.ENSP00000349955.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi6 – 1510
Helixi20 – 3213
Helixi34 – 363
Helixi37 – 5014
Helixi53 – 553
Helixi56 – 7015
Turni71 – 733
Helixi76 – 9520
Helixi98 – 11316
Helixi119 – 13012

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4JXTX-ray1.90A1-137[»]
4NACX-ray2.00A/B1-131[»]
ProteinModelPortaliQ96P16.
SMRiQ96P16. Positions 2-131, 163-290.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 133132CID
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili244 – 28643 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Belongs to the UPF0400 (RTT103) family.
Contains 1 CID domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG291577.
HOGENOMiHOG000007456.
HOVERGENiHBG051177.
InParanoidiQ96P16.
OMAiALTETHE.
PhylomeDBiQ96P16.
TreeFamiTF320926.

Family and domain databases

Gene3Di1.25.40.90. 1 hit.
InterProiIPR006569. CID_dom.
IPR008942. ENTH_VHS.
IPR006903. RNA_pol_II-bd.
[Graphical view]
PfamiPF04818. CTD_bind. 1 hit.
[Graphical view]
SMARTiSM00582. RPR. 1 hit.
[Graphical view]
SUPFAMiSSF48464. SSF48464. 1 hit.
PROSITEiPS51391. CID. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96P16-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSAFSEAALE KKLSELSNSQ QSVQTLSLWL IHHRKHSRPI VTVWERELRK    50
AKPNRKLTFL YLANDVIQNS KRKGPEFTKD FAPVIVEAFK HVSSETDESC 100
KKHLGRVLSI WEERSVYEND VLEQLKQALY GDKKPRKRTY EQIKVDENEN 150
CSSLGSPSEP PQTLDLVRAL QDLENAASGD AAVHQRIASL PVEVQEVSLL 200
DKITDKESGE RLSKMVEDAC MLLADYNGRL AAEIDDRKQL TRMLADFLRC 250
QKEALAEKEH KLEEYKRKLA RVSLVRKELR SRIQSLPDLS RLPNVTGSHM 300
HLPFAGDIYS ED 312
Length:312
Mass (Da):35,720
Last modified:December 1, 2001 - v1
Checksum:i61785281F31CB328
GO
Isoform 2 (identifier: Q96P16-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRKA → MRNSNWRFCQTGIYS

Show »
Length:276
Mass (Da):31,625
Checksum:i09748C553C326E55
GO

Sequence cautioni

The sequence AAH10136.1 differs from that shown. Reason: Probable cloning artifact.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti21 – 211Q → H in a breast cancer sample; somatic mutation. 1 Publication
VAR_037229

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151MSAFS…ELRKA → MRNSNWRFCQTGIYS in isoform 2.
VSP_029531Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti193 – 1931E → D in BAA91736. 1 Publication
Sequence conflicti234 – 2341I → V in BAA91736. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF419845 mRNA. Translation: AAL15972.1.
AK001518 mRNA. Translation: BAA91736.1.
AK292907 mRNA. Translation: BAF85596.1.
AK314569 mRNA. Translation: BAG37150.1.
CH471088 Genomic DNA. Translation: EAX01365.1.
CH471088 Genomic DNA. Translation: EAX01366.1.
CH471088 Genomic DNA. Translation: EAX01367.1.
BC000225 mRNA. Translation: AAH00225.2.
BC010136 mRNA. Translation: AAH10136.1. Sequence problems.
CCDSiCCDS11917.1. [Q96P16-1]
RefSeqiNP_060640.2. NM_018170.3. [Q96P16-1]
XP_005258350.1. XM_005258293.1.
XP_005258351.1. XM_005258294.1. [Q96P16-3]
UniGeneiHs.464912.

Genome annotation databases

EnsembliENST00000319040; ENSP00000314602; ENSG00000141425.
ENST00000337059; ENSP00000337476; ENSG00000141425. [Q96P16-3]
ENST00000357384; ENSP00000349955; ENSG00000141425. [Q96P16-1]
ENST00000399022; ENSP00000381984; ENSG00000141425. [Q96P16-1]
ENST00000588737; ENSP00000465444; ENSG00000141425. [Q96P16-3]
ENST00000589050; ENSP00000468209; ENSG00000141425.
ENST00000590898; ENSP00000467991; ENSG00000141425. [Q96P16-3]
GeneIDi55197.
KEGGihsa:55197.
UCSCiuc002kze.1. human. [Q96P16-3]
uc002kzg.3. human. [Q96P16-1]

Polymorphism databases

DMDMi74717048.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF419845 mRNA. Translation: AAL15972.1 .
AK001518 mRNA. Translation: BAA91736.1 .
AK292907 mRNA. Translation: BAF85596.1 .
AK314569 mRNA. Translation: BAG37150.1 .
CH471088 Genomic DNA. Translation: EAX01365.1 .
CH471088 Genomic DNA. Translation: EAX01366.1 .
CH471088 Genomic DNA. Translation: EAX01367.1 .
BC000225 mRNA. Translation: AAH00225.2 .
BC010136 mRNA. Translation: AAH10136.1 . Sequence problems.
CCDSi CCDS11917.1. [Q96P16-1 ]
RefSeqi NP_060640.2. NM_018170.3. [Q96P16-1 ]
XP_005258350.1. XM_005258293.1.
XP_005258351.1. XM_005258294.1. [Q96P16-3 ]
UniGenei Hs.464912.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4JXT X-ray 1.90 A 1-137 [» ]
4NAC X-ray 2.00 A/B 1-131 [» ]
ProteinModelPortali Q96P16.
SMRi Q96P16. Positions 2-131, 163-290.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120494. 21 interactions.
IntActi Q96P16. 7 interactions.
MINTi MINT-4537177.
STRINGi 9606.ENSP00000349955.

PTM databases

PhosphoSitei Q96P16.

Polymorphism databases

DMDMi 74717048.

Proteomic databases

MaxQBi Q96P16.
PaxDbi Q96P16.
PRIDEi Q96P16.

Protocols and materials databases

DNASUi 55197.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000319040 ; ENSP00000314602 ; ENSG00000141425 .
ENST00000337059 ; ENSP00000337476 ; ENSG00000141425 . [Q96P16-3 ]
ENST00000357384 ; ENSP00000349955 ; ENSG00000141425 . [Q96P16-1 ]
ENST00000399022 ; ENSP00000381984 ; ENSG00000141425 . [Q96P16-1 ]
ENST00000588737 ; ENSP00000465444 ; ENSG00000141425 . [Q96P16-3 ]
ENST00000589050 ; ENSP00000468209 ; ENSG00000141425 .
ENST00000590898 ; ENSP00000467991 ; ENSG00000141425 . [Q96P16-3 ]
GeneIDi 55197.
KEGGi hsa:55197.
UCSCi uc002kze.1. human. [Q96P16-3 ]
uc002kzg.3. human. [Q96P16-1 ]

Organism-specific databases

CTDi 55197.
GeneCardsi GC18M033569.
H-InvDB HIX0014404.
HGNCi HGNC:25560. RPRD1A.
HPAi HPA040602.
MIMi 610347. gene.
neXtProti NX_Q96P16.
PharmGKBi PA162402042.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG291577.
HOGENOMi HOG000007456.
HOVERGENi HBG051177.
InParanoidi Q96P16.
OMAi ALTETHE.
PhylomeDBi Q96P16.
TreeFami TF320926.

Miscellaneous databases

ChiTaRSi RPRD1A. human.
GenomeRNAii 55197.
NextBioi 59071.
PROi Q96P16.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96P16.
Bgeei Q96P16.
CleanExi HS_RPRD1A.
Genevestigatori Q96P16.

Family and domain databases

Gene3Di 1.25.40.90. 1 hit.
InterProi IPR006569. CID_dom.
IPR008942. ENTH_VHS.
IPR006903. RNA_pol_II-bd.
[Graphical view ]
Pfami PF04818. CTD_bind. 1 hit.
[Graphical view ]
SMARTi SM00582. RPR. 1 hit.
[Graphical view ]
SUPFAMi SSF48464. SSF48464. 1 hit.
PROSITEi PS51391. CID. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and characterization of P15RS, a novel P15(INK4b) related gene on G1/S progression."
    Liu J., Liu H., Zhang X., Gao P., Wang J., Hu Z.
    Biochem. Biophys. Res. Commun. 299:880-885(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION, INDUCTION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta, Teratocarcinoma and Trachea.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-263 (ISOFORM 1).
    Tissue: Eye and Muscle.
  5. Bienvenut W.V., Bilsland A.E., Keith W.N.
    Submitted (JAN-2010) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-12; 107-114; 169-186; 230-237; 243-249 AND 283-291, CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Colon carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B."
    Ni Z., Olsen J.B., Guo X., Zhong G., Ruan E.D., Marcon E., Young P., Guo H., Li J., Moffat J., Emili A., Greenblatt J.F.
    Transcription 2:237-242(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE RNA POLYMERASE II COMPLEX, FUNCTION.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-21.

Entry informationi

Entry nameiRPR1A_HUMAN
AccessioniPrimary (citable) accession number: Q96P16
Secondary accession number(s): A8KA42
, B2RBA3, Q7Z5G8, Q96FY9, Q9NVL4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
  7. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries

External Data

Dasty 3

Similar proteinsi