Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Proline-rich acidic protein 1

Gene

PRAP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May play an important role in maintaining normal growth homeostasis in epithelial cells.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Proline-rich acidic protein 1
Alternative name(s):
Epididymis tissue protein Li 178
Uterine-specific proline-rich acidic protein
Gene namesi
Name:PRAP1
Synonyms:UPA
ORF Names:UNQ608/PRO1195
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23304. PRAP1.

Subcellular locationi

  • Secreted 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi118471.
OpenTargetsiENSG00000165828.
PharmGKBiPA134981678.

Polymorphism and mutation databases

BioMutaiPRAP1.
DMDMi317373269.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 20Sequence analysisAdd BLAST20
ChainiPRO_000029941621 – 151Proline-rich acidic protein 1Add BLAST131

Proteomic databases

PaxDbiQ96NZ9.
PeptideAtlasiQ96NZ9.
PRIDEiQ96NZ9.

PTM databases

iPTMnetiQ96NZ9.
PhosphoSitePlusiQ96NZ9.

Expressioni

Tissue specificityi

Abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. Significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues. Expressed in epididymis (at protein level).2 Publications

Inductioni

Up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine.1 Publication

Gene expression databases

BgeeiENSG00000165828.
CleanExiHS_PRAP1.
ExpressionAtlasiQ96NZ9. baseline and differential.
GenevisibleiQ96NZ9. HS.

Organism-specific databases

HPAiHPA038713.
HPA052451.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SGTAO437655EBI-2116102,EBI-347996
UBQLN1Q9UMX03EBI-2116102,EBI-741480
UBQLN1Q9UMX0-23EBI-2116102,EBI-10173939

Protein-protein interaction databases

BioGridi125610. 7 interactors.
IntActiQ96NZ9. 5 interactors.
STRINGi9606.ENSP00000416126.

Structurei

3D structure databases

ProteinModelPortaliQ96NZ9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410J3WZ. Eukaryota.
ENOG4111CMU. LUCA.
GeneTreeiENSGT00390000012626.
HOVERGENiHBG099538.
InParanoidiQ96NZ9.
PhylomeDBiQ96NZ9.
TreeFamiTF337049.

Family and domain databases

InterProiIPR027922. PRAP.
[Graphical view]
PfamiPF15314. PRAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96NZ9-1) [UniParc]FASTAAdd to basket
Also known as: PRAP

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRLLLVTSL VVVLLWEAGA VPAPKVPIKM QVKHWPSEQD PEKAWGARVV
60 70 80 90 100
EPPEKDDQLV VLFPVQKPKL LTTEEKPRGQ GRGPILPGTK AWMETEDTLG
110 120 130 140 150
HVLSPEPDHD SLYHPPPEED QGEERPRLWV MPNHQVLLGP EEDQDHIYHP

Q
Length:151
Mass (Da):17,208
Last modified:January 11, 2011 - v2
Checksum:iB751EDBFD24D08CA
GO
Isoform 2 (identifier: Q96NZ9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     79-87: Missing.
     95-151: TEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ → SRARP

Show »
Length:90
Mass (Da):10,259
Checksum:iE8C3C22D12F8E9CC
GO
Isoform 3 (identifier: Q96NZ9-3) [UniParc]FASTAAdd to basket
Also known as: PRAPV1

The sequence of this isoform differs from the canonical sequence as follows:
     43-43: K → NR

Show »
Length:152
Mass (Da):17,350
Checksum:i026C7D3AE8C988E1
GO
Isoform 4 (identifier: Q96NZ9-4) [UniParc]FASTAAdd to basket
Also known as: PRAPV2

The sequence of this isoform differs from the canonical sequence as follows:
     79-87: Missing.

Show »
Length:142
Mass (Da):16,332
Checksum:i149282D65B6346E6
GO

Sequence cautioni

The sequence AAP97247 differs from that shown. Reason: Frameshift at positions 81 and 86.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03481554E → G.1 Publication1
Natural variantiVAR_03481669K → R.1 Publication1
Natural variantiVAR_03481781G → S.Corresponds to variant rs34780987dbSNPEnsembl.1
Natural variantiVAR_034818101H → R.6 PublicationsCorresponds to variant rs4369319dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02766043K → NR in isoform 3. 1 Publication1
Alternative sequenceiVSP_02766179 – 87Missing in isoform 2 and isoform 4. 2 Publications9
Alternative sequenceiVSP_02766295 – 151TEDTL…IYHPQ → SRARP in isoform 2. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF421885 mRNA. Translation: AAL16670.1.
AY158074 mRNA. Translation: AAN87018.1.
AF123768 mRNA. Translation: AAP97247.1. Frameshift.
AY358908 mRNA. Translation: AAQ89267.1.
GU727628 mRNA. Translation: ADU87630.1.
AL360181 Genomic DNA. Translation: CAH70283.1.
CH471211 Genomic DNA. Translation: EAW61336.1.
BC029447 mRNA. Translation: AAH29447.2.
BC061643 mRNA. Translation: AAH61643.1.
BC071872 mRNA. Translation: AAH71872.1.
BC093853 mRNA. Translation: AAH93853.1.
BC101743 mRNA. Translation: AAI01744.1.
BC143590 mRNA. Translation: AAI43591.1.
BC143592 mRNA. Translation: AAI43593.1.
BC143591 mRNA. Translation: AAI43592.1.
CCDSiCCDS44498.1. [Q96NZ9-4]
CCDS7679.1. [Q96NZ9-1]
RefSeqiNP_001138673.1. NM_001145201.1. [Q96NZ9-4]
NP_660203.3. NM_145202.4. [Q96NZ9-1]
UniGeneiHs.15951.

Genome annotation databases

EnsembliENST00000433452; ENSP00000416126; ENSG00000165828. [Q96NZ9-1]
ENST00000463201; ENSP00000486265; ENSG00000165828. [Q96NZ9-4]
GeneIDi118471.
KEGGihsa:118471.
UCSCiuc001lmp.3. human. [Q96NZ9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF421885 mRNA. Translation: AAL16670.1.
AY158074 mRNA. Translation: AAN87018.1.
AF123768 mRNA. Translation: AAP97247.1. Frameshift.
AY358908 mRNA. Translation: AAQ89267.1.
GU727628 mRNA. Translation: ADU87630.1.
AL360181 Genomic DNA. Translation: CAH70283.1.
CH471211 Genomic DNA. Translation: EAW61336.1.
BC029447 mRNA. Translation: AAH29447.2.
BC061643 mRNA. Translation: AAH61643.1.
BC071872 mRNA. Translation: AAH71872.1.
BC093853 mRNA. Translation: AAH93853.1.
BC101743 mRNA. Translation: AAI01744.1.
BC143590 mRNA. Translation: AAI43591.1.
BC143592 mRNA. Translation: AAI43593.1.
BC143591 mRNA. Translation: AAI43592.1.
CCDSiCCDS44498.1. [Q96NZ9-4]
CCDS7679.1. [Q96NZ9-1]
RefSeqiNP_001138673.1. NM_001145201.1. [Q96NZ9-4]
NP_660203.3. NM_145202.4. [Q96NZ9-1]
UniGeneiHs.15951.

3D structure databases

ProteinModelPortaliQ96NZ9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125610. 7 interactors.
IntActiQ96NZ9. 5 interactors.
STRINGi9606.ENSP00000416126.

PTM databases

iPTMnetiQ96NZ9.
PhosphoSitePlusiQ96NZ9.

Polymorphism and mutation databases

BioMutaiPRAP1.
DMDMi317373269.

Proteomic databases

PaxDbiQ96NZ9.
PeptideAtlasiQ96NZ9.
PRIDEiQ96NZ9.

Protocols and materials databases

DNASUi118471.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000433452; ENSP00000416126; ENSG00000165828. [Q96NZ9-1]
ENST00000463201; ENSP00000486265; ENSG00000165828. [Q96NZ9-4]
GeneIDi118471.
KEGGihsa:118471.
UCSCiuc001lmp.3. human. [Q96NZ9-1]

Organism-specific databases

CTDi118471.
DisGeNETi118471.
GeneCardsiPRAP1.
HGNCiHGNC:23304. PRAP1.
HPAiHPA038713.
HPA052451.
MIMi609776. gene.
neXtProtiNX_Q96NZ9.
OpenTargetsiENSG00000165828.
PharmGKBiPA134981678.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J3WZ. Eukaryota.
ENOG4111CMU. LUCA.
GeneTreeiENSGT00390000012626.
HOVERGENiHBG099538.
InParanoidiQ96NZ9.
PhylomeDBiQ96NZ9.
TreeFamiTF337049.

Miscellaneous databases

GenomeRNAii118471.
PROiQ96NZ9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165828.
CleanExiHS_PRAP1.
ExpressionAtlasiQ96NZ9. baseline and differential.
GenevisibleiQ96NZ9. HS.

Family and domain databases

InterProiIPR027922. PRAP.
[Graphical view]
PfamiPF15314. PRAP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPRAP1_HUMAN
AccessioniPrimary (citable) accession number: Q96NZ9
Secondary accession number(s): B7ZL57
, B7ZL58, E9KL31, Q5VWY4, Q7Z4X5, Q8IWR3, Q8NCS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: January 11, 2011
Last modified: November 30, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.