Q96NZ9 (PRAP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Proline-rich acidic protein 1 Alternative name(s): Epididymis tissue protein Li 178 Uterine-specific proline-rich acidic protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 151 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play an important role in maintaining normal growth homeostasis in epithelial cells. Ref.1 |
| Subcellular location | |
| Tissue specificity | Abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. Significantly down-regulated in hepatocellular carcinoma and right colon adenocarcinoma compared with the respective adjacent normal tissues. Expressed in epididymis (at protein level). Ref.1 Ref.2 |
| Induction | Up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. Ref.1 |
| Sequence caution | The sequence AAP97247.1 differs from that shown. Reason: Frameshift at positions 81 and 86. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96NZ9-1) Also known as: PRAP; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96NZ9-2) The sequence of this isoform differs from the canonical sequence as follows: 79-87: Missing. 95-151: TEDTLGHVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQ → SRARP | ||||||
| Isoform 3 (identifier: Q96NZ9-3) Also known as: PRAPV1; The sequence of this isoform differs from the canonical sequence as follows: 43-43: K → NR | ||||||
| Isoform 4 (identifier: Q96NZ9-4) Also known as: PRAPV2; The sequence of this isoform differs from the canonical sequence as follows: 79-87: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||
| Chain | 21 – 151 | 131 | Proline-rich acidic protein 1 | PRO_0000299416 | |||||
Natural variations | |||||||||
| Alternative sequence | 43 | 1 | K → NR in isoform 3. | VSP_027660 | |||||
| Alternative sequence | 79 – 87 | 9 | Missing in isoform 2 and isoform 4. | VSP_027661 | |||||
| Alternative sequence | 95 – 151 | 57 | TEDTL…IYHPQ → SRARP in isoform 2. | VSP_027662 | |||||
| Natural variant | 54 | 1 | E → G in PRAPV3. Ref.1 | VAR_034815 | |||||
| Natural variant | 69 | 1 | K → R in PRAPV4. Ref.1 | VAR_034816 | |||||
| Natural variant | 81 | 1 | G → S. Corresponds to variant rs34780987 [ dbSNP | Ensembl ]. | VAR_034817 | |||||
| Natural variant | 101 | 1 | H → R. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7 Corresponds to variant rs4369319 [ dbSNP | Ensembl ]. | VAR_034818 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The proline-rich acidic protein is epigenetically regulated and inhibits growth of cancer cell lines." Zhang J., Wong H., Ramanan S., Cheong D., Leong A., Hooi S.C. Cancer Res. 63:6658-6665(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 4), FUNCTION, INDUCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS GLY-54; ARG-69 AND ARG-101. |
| [2] | "Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins." Li J., Liu F., Wang H., Liu X., Liu J., Li N., Wan F., Wang W., Zhang C., Jin S., Liu J., Zhu P., Liu Y. Mol. Cell. Proteomics 9:2517-2528(2010) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-101, TISSUE SPECIFICITY. Tissue: Epididymis. |
| [3] | "A novel human cDNA homologous to Mus musculus uterine-specific proline-rich acidic protein mRNA." Zheng L.H., Yu L., Zhao S.Y. Submitted (JAN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-101. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ARG-101. |
| [5] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ARG-101. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 4-151 (ISOFORM 3), VARIANT ARG-101. Tissue: Liver and Pancreas. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF421885 mRNA. Translation: AAL16670.1. AY158074 mRNA. Translation: AAN87018.1. AF123768 mRNA. Translation: AAP97247.1. Frameshift. AY358908 mRNA. Translation: AAQ89267.1. GU727628 mRNA. Translation: ADU87630.1. AL360181 Genomic DNA. Translation: CAH70283.1. CH471211 Genomic DNA. Translation: EAW61336.1. BC029447 mRNA. Translation: AAH29447.2. BC061643 mRNA. Translation: AAH61643.1. BC071872 mRNA. Translation: AAH71872.1. BC093853 mRNA. Translation: AAH93853.1. BC101743 mRNA. Translation: AAI01744.1. BC143590 mRNA. Translation: AAI43591.1. BC143592 mRNA. Translation: AAI43593.1. BC143591 mRNA. Translation: AAI43592.1. |
| IPI | IPI00465255. IPI00855875. IPI00855900. IPI00855928. |
| RefSeq | NP_001138673.1. NM_001145201.1. NP_660203.3. NM_145202.4. |
| UniGene | Hs.15951. |
3D structure databases | |
| ProteinModelPortal | Q96NZ9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96NZ9. 1 interaction. |
| STRING | 9606.ENSP00000416126. |
Polymorphism databases | |
| DMDM | 74752065. |
Proteomic databases | |
| PaxDb | Q96NZ9. |
| PRIDE | Q96NZ9. |
Protocols and materials databases | |
| DNASU | 118471. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000423766; ENSP00000409495; ENSG00000165828. ENST00000433452; ENSP00000416126; ENSG00000165828. ENST00000458230; ENSP00000402700; ENSG00000165828. |
| GeneID | 118471. |
| KEGG | hsa:118471. |
| UCSC | uc001lmp.2. human. uc001lmq.1. human. |
Organism-specific databases | |
| CTD | 118471. |
| GeneCards | GC10P135160. |
| HGNC | HGNC:23304. PRAP1. |
| HPA | HPA038713. |
| MIM | 609776. gene. |
| neXtProt | NX_Q96NZ9. |
| PharmGKB | PA134981678. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG45245. |
| HOVERGEN | HBG099538. |
| InParanoid | Q96NZ9. |
| OrthoDB | EOG43JC65. |
| PhylomeDB | Q96NZ9. |
Gene expression databases | |
| ArrayExpress | Q96NZ9. |
| Bgee | Q96NZ9. |
| CleanEx | HS_PRAP1. |
| Genevestigator | Q96NZ9. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 118471. |
| NextBio | 80300. |
| SOURCE | Search... |
Entry information
| Entry name | PRAP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96NZ9 Secondary accession number(s): B7ZL57 Q8NCS2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
