SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96NM4

- TOX2_HUMAN

UniProt

Q96NM4 - TOX2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
TOX high mobility group box family member 2
Gene
TOX2, C20orf100, GCX1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Putative transcriptional activator involved in the hypothalamo-pituitary-gonadal system.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi255 – 32369HMG box
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
Complete GO annotation...

GO - Biological processi

  1. female gonad development Source: Ensembl
  2. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  3. response to gonadotropin Source: Ensembl
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
TOX high mobility group box family member 2
Alternative name(s):
Granulosa cell HMG box protein 1
Short name:
GCX-1
Gene namesi
Name:TOX2
Synonyms:C20orf100, GCX1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:16095. TOX2.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162406727.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 488488TOX high mobility group box family member 2
PRO_0000048571Add
BLAST

Proteomic databases

MaxQBiQ96NM4.
PaxDbiQ96NM4.
PRIDEiQ96NM4.

PTM databases

PhosphoSiteiQ96NM4.

Expressioni

Gene expression databases

ArrayExpressiQ96NM4.
BgeeiQ96NM4.
CleanExiHS_TOX2.
GenevestigatoriQ96NM4.

Organism-specific databases

HPAiHPA049900.

Interactioni

Protein-protein interaction databases

BioGridi124399. 3 interactions.
STRINGi9606.ENSP00000344724.

Structurei

3D structure databases

ProteinModelPortaliQ96NM4.
SMRiQ96NM4. Positions 251-302.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni76 – 11439Required for transcriptional activation By similarity
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi223 – 25230Nuclear localization signal By similarity
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi245 – 2506Poly-Lys
Compositional biasi372 – 45685Pro-rich
Add
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG291143.
HOGENOMiHOG000230949.
HOVERGENiHBG051183.
OMAiDHEASYH.
OrthoDBiEOG7R834J.
PhylomeDBiQ96NM4.
TreeFamiTF106481.

Family and domain databases

Gene3Di1.10.30.10. 1 hit.
InterProiIPR009071. HMG_box_dom.
[Graphical view]
PfamiPF00505. HMG_box. 1 hit.
[Graphical view]
SMARTiSM00398. HMG. 1 hit.
[Graphical view]
SUPFAMiSSF47095. SSF47095. 1 hit.
PROSITEiPS50118. HMG_BOX_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96NM4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQQTRTEAVA GAFSRCLGFC GMRLGLLLLA RHWCIAGVFP QKFDGDSAYV    50
GMSDGNPELL STSQTYNGQS ENNEDYEIPP ITPPNLPEPS LLHLGDHEAS 100
YHSLCHGLTP NGLLPAYSYQ AMDLPAIMVS NMLAQDSHLL SGQLPTIQEM 150
VHSEVAAYDS GRPGPLLGRP AMLASHMSAL SQSQLISQMG IRSSIAHSSP 200
SPPGSKSATP SPSSSTQEEE SEVHFKISGE KRPSADPGKK AKNPKKKKKK 250
DPNEPQKPVS AYALFFRDTQ AAIKGQNPSA TFGDVSKIVA SMWDSLGEEQ 300
KQSSPDQGET KSTQANPPAK MLPPKQPMYA MPGLASFLTP SDLQAFRSGA 350
SPASLARTLG SKSLLPGLSA SPPPPPSFPL SPTLHQQLSL PPHAQGALLS 400
PPVSMSPAPQ PPVLPTPMAL QVQLAMSPSP PGPQDFPHIS EFPSSSGSCS 450
PGPSNPTSSG DWDSSYPSGE CGISTCSLLP RDKSLYLT 488
Length:488
Mass (Da):51,604
Last modified:October 19, 2002 - v2
Checksum:i687FD144CF30731A
GO
Isoform 2 (identifier: Q96NM4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Note: No experimental confirmation available.

Show »
Length:515
Mass (Da):54,645
Checksum:i5B9ED0A9228B1449
GO
Isoform 3 (identifier: Q96NM4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Note: No experimental confirmation available.

Show »
Length:464
Mass (Da):49,112
Checksum:i07E22E3F3E8D782A
GO
Isoform 4 (identifier: Q96NM4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MQQTRTEAVAGAFSRCLGFCGMRLGLLLLARHWCIAGVFPQ → MDVRLYPSAPAVGARPGAEPAGLAHLDYYHGG
     302-302: Q → QAYKRKTEAAKKEYLKALAAYRASLVSK

Show »
Length:506
Mass (Da):53,444
Checksum:iE5B3941DAA4E8536
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti223 – 2231V → A.
Corresponds to variant rs6103584 [ dbSNP | Ensembl ].
VAR_049560

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5151Missing in isoform 3.
VSP_045645Add
BLAST
Alternative sequencei1 – 4141MQQTR…GVFPQ → MDVRLYPSAPAVGARPGAEP AGLAHLDYYHGG in isoform 4.
VSP_047108Add
BLAST
Alternative sequencei302 – 3021Q → QAYKRKTEAAKKEYLKALAA YRASLVSK in isoform 2, isoform 3 and isoform 4.
VSP_002187

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti372 – 3721P → PP in BAF82595. 1 Publication
Sequence conflicti482 – 4821D → N in BAB70860. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK055135 mRNA. Translation: BAB70860.1.
AK289906 mRNA. Translation: BAF82595.1.
AL121587, AL034419 Genomic DNA. Translation: CAI21559.1.
AL121587, AL034419 Genomic DNA. Translation: CAI21560.1.
AL121587, AL034419 Genomic DNA. Translation: CAI21561.1.
AL034419, AL121587 Genomic DNA. Translation: CAI42198.1.
AL034419, AL121587 Genomic DNA. Translation: CAI42200.1.
AL034419, AL121587 Genomic DNA. Translation: CAI42201.1.
AL035089 Genomic DNA. No translation available.
AL353797 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW75944.1.
CH471077 Genomic DNA. Translation: EAW75945.1.
CH471077 Genomic DNA. Translation: EAW75946.1.
BC007636 mRNA. No translation available.
CCDSiCCDS13324.1. [Q96NM4-3]
CCDS42875.1. [Q96NM4-1]
CCDS46603.1. [Q96NM4-4]
RefSeqiNP_001092266.1. NM_001098796.1. [Q96NM4-3]
NP_001092267.1. NM_001098797.1. [Q96NM4-4]
NP_001092268.1. NM_001098798.1. [Q96NM4-1]
NP_116272.1. NM_032883.2. [Q96NM4-3]
XP_006723947.1. XM_006723884.1. [Q96NM4-2]
UniGeneiHs.26608.

Genome annotation databases

EnsembliENST00000341197; ENSP00000344724; ENSG00000124191. [Q96NM4-4]
ENST00000358131; ENSP00000350849; ENSG00000124191. [Q96NM4-1]
ENST00000372999; ENSP00000362090; ENSG00000124191. [Q96NM4-3]
ENST00000423191; ENSP00000390278; ENSG00000124191. [Q96NM4-3]
GeneIDi84969.
KEGGihsa:84969.
UCSCiuc002xle.4. human.
uc002xlf.4. human. [Q96NM4-1]
uc010ggo.3. human.

Polymorphism databases

DMDMi24211591.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK055135 mRNA. Translation: BAB70860.1 .
AK289906 mRNA. Translation: BAF82595.1 .
AL121587 , AL034419 Genomic DNA. Translation: CAI21559.1 .
AL121587 , AL034419 Genomic DNA. Translation: CAI21560.1 .
AL121587 , AL034419 Genomic DNA. Translation: CAI21561.1 .
AL034419 , AL121587 Genomic DNA. Translation: CAI42198.1 .
AL034419 , AL121587 Genomic DNA. Translation: CAI42200.1 .
AL034419 , AL121587 Genomic DNA. Translation: CAI42201.1 .
AL035089 Genomic DNA. No translation available.
AL353797 Genomic DNA. No translation available.
CH471077 Genomic DNA. Translation: EAW75944.1 .
CH471077 Genomic DNA. Translation: EAW75945.1 .
CH471077 Genomic DNA. Translation: EAW75946.1 .
BC007636 mRNA. No translation available.
CCDSi CCDS13324.1. [Q96NM4-3 ]
CCDS42875.1. [Q96NM4-1 ]
CCDS46603.1. [Q96NM4-4 ]
RefSeqi NP_001092266.1. NM_001098796.1. [Q96NM4-3 ]
NP_001092267.1. NM_001098797.1. [Q96NM4-4 ]
NP_001092268.1. NM_001098798.1. [Q96NM4-1 ]
NP_116272.1. NM_032883.2. [Q96NM4-3 ]
XP_006723947.1. XM_006723884.1. [Q96NM4-2 ]
UniGenei Hs.26608.

3D structure databases

ProteinModelPortali Q96NM4.
SMRi Q96NM4. Positions 251-302.
ModBasei Search...

Protein-protein interaction databases

BioGridi 124399. 3 interactions.
STRINGi 9606.ENSP00000344724.

PTM databases

PhosphoSitei Q96NM4.

Polymorphism databases

DMDMi 24211591.

Proteomic databases

MaxQBi Q96NM4.
PaxDbi Q96NM4.
PRIDEi Q96NM4.

Protocols and materials databases

DNASUi 84969.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341197 ; ENSP00000344724 ; ENSG00000124191 . [Q96NM4-4 ]
ENST00000358131 ; ENSP00000350849 ; ENSG00000124191 . [Q96NM4-1 ]
ENST00000372999 ; ENSP00000362090 ; ENSG00000124191 . [Q96NM4-3 ]
ENST00000423191 ; ENSP00000390278 ; ENSG00000124191 . [Q96NM4-3 ]
GeneIDi 84969.
KEGGi hsa:84969.
UCSCi uc002xle.4. human.
uc002xlf.4. human. [Q96NM4-1 ]
uc010ggo.3. human.

Organism-specific databases

CTDi 84969.
GeneCardsi GC20P042543.
HGNCi HGNC:16095. TOX2.
HPAi HPA049900.
MIMi 611163. gene.
neXtProti NX_Q96NM4.
PharmGKBi PA162406727.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG291143.
HOGENOMi HOG000230949.
HOVERGENi HBG051183.
OMAi DHEASYH.
OrthoDBi EOG7R834J.
PhylomeDBi Q96NM4.
TreeFami TF106481.

Miscellaneous databases

GenomeRNAii 84969.
NextBioi 35463834.
PROi Q96NM4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96NM4.
Bgeei Q96NM4.
CleanExi HS_TOX2.
Genevestigatori Q96NM4.

Family and domain databases

Gene3Di 1.10.30.10. 1 hit.
InterProi IPR009071. HMG_box_dom.
[Graphical view ]
Pfami PF00505. HMG_box. 1 hit.
[Graphical view ]
SMARTi SM00398. HMG. 1 hit.
[Graphical view ]
SUPFAMi SSF47095. SSF47095. 1 hit.
PROSITEi PS50118. HMG_BOX_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Brain and Corpus callosum.
  2. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Muscle.

Entry informationi

Entry nameiTOX2_HUMAN
AccessioniPrimary (citable) accession number: Q96NM4
Secondary accession number(s): A8K1J1
, E1P5X0, G3XAC7, Q5TE33, Q5TE34, Q5TE35, Q96IC9, Q9BQN5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 19, 2002
Last modified: September 3, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi