Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 396

Gene

ZNF396

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1 and isoform 2 act as DNA-dependent transcriptional repressors.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri251 – 27323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri279 – 30123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri307 – 32923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 396
Alternative name(s):
Zinc finger and SCAN domain-containing protein 14
Gene namesi
Name:ZNF396
Synonyms:ZSCAN14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:18824. ZNF396.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38697.

Polymorphism and mutation databases

BioMutaiZNF396.
DMDMi38258950.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 335335Zinc finger protein 396PRO_0000047563Add
BLAST

Proteomic databases

PaxDbiQ96N95.
PeptideAtlasiQ96N95.
PRIDEiQ96N95.
TopDownProteomicsiQ96N95-3. [Q96N95-3]

PTM databases

iPTMnetiQ96N95.
PhosphoSiteiQ96N95.

Expressioni

Tissue specificityi

Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate.1 Publication

Gene expression databases

BgeeiENSG00000186496.
CleanExiHS_ZNF396.
ExpressionAtlasiQ96N95. baseline and differential.
GenevisibleiQ96N95. HS.

Organism-specific databases

HPAiHPA006686.

Interactioni

Subunit structurei

Isoforms 1 and 2 can both homo- and hetero-associate.1 Publication

Protein-protein interaction databases

BioGridi128934. 14 interactions.
STRINGi9606.ENSP00000302310.

Structurei

3D structure databases

ProteinModelPortaliQ96N95.
SMRiQ96N95. Positions 45-135, 248-329.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 13483SCAN boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri251 – 27323C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri279 – 30123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri307 – 32923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiQ96N95.
KOiK09230.
OMAiYACDECA.
OrthoDBiEOG091G09O3.
PhylomeDBiQ96N95.
TreeFamiTF338304.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 3 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96N95-1) [UniParc]FASTAAdd to basket
Also known as: ZNF396-fu

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKLGKSSS LLTQTSEECN GILTEKMEEE EQTCDPDSSL HWSSSYSPET
60 70 80 90 100
FRQQFRQFGY QDSPGPHEAL SRLWELCHLW LRPEVHTKEQ ILELLVLEQF
110 120 130 140 150
LAILPKELQA WVQKHHPENG EETVTMLEDV ERELDGPKQI FFGRRKDMIA
160 170 180 190 200
EKLAPSEITE ELPSSQLMPV KKQLQGASWE LQSLRPHDED IKTTNVKSAS
210 220 230 240 250
RQKTSLGIEL HCNVSNILHM NGSQSSTYRG TYEQDGRFEK RQGNPSWKKQ
260 270 280 290 300
QKCDECGKIF SQSSALILHQ RIHSGKKPYA CDECAKAFSR SAILIQHRRT
310 320 330
HTGEKPYKCH DCGKAFSQSS NLFRHRKRHI RKKVP
Length:335
Mass (Da):38,612
Last modified:October 31, 2003 - v2
Checksum:i2EC72390016E3E4F
GO
Isoform 2 (identifier: Q96N95-2) [UniParc]FASTAAdd to basket
Also known as: Truncated, ZNF396-nf

The sequence of this isoform differs from the canonical sequence as follows:
     188-210: DEDIKTTNVKSASRQKTSLGIEL → GEGAGFSSCWKVWGPSAHHTHLS
     211-335: Missing.

Show »
Length:210
Mass (Da):24,061
Checksum:i59B01660963377C1
GO
Isoform 3 (identifier: Q96N95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-335: GEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP → DSKYEHAIAEAQKNMYFKTRLKCPRSLSGGR

Note: No experimental confirmation available.
Show »
Length:333
Mass (Da):38,258
Checksum:i138811B6D0533261
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti125 – 1251T → A in AAM09559 (PubMed:12801647).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti211 – 2111H → L.
Corresponds to variant rs9963473 [ dbSNP | Ensembl ].
VAR_057418

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei188 – 21023DEDIK…LGIEL → GEGAGFSSCWKVWGPSAHHT HLS in isoform 2. 1 PublicationVSP_008768Add
BLAST
Alternative sequencei211 – 335125Missing in isoform 2. 1 PublicationVSP_006923Add
BLAST
Alternative sequencei303 – 33533GEKPY…RKKVP → DSKYEHAIAEAQKNMYFKTR LKCPRSLSGGR in isoform 3. 2 PublicationsVSP_020993Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492004 mRNA. Translation: AAM09559.3.
AF533251 mRNA. Translation: AAM95992.1.
AK055775 mRNA. Translation: BAB71010.1.
CH471088 Genomic DNA. Translation: EAX01352.1.
BC130288 mRNA. Translation: AAI30289.1.
BC136314 mRNA. Translation: AAI36315.1.
CCDSiCCDS11913.1. [Q96N95-3]
RefSeqiNP_001309215.1. NM_001322286.1. [Q96N95-1]
NP_001309219.1. NM_001322290.1. [Q96N95-1]
NP_001309220.1. NM_001322291.1. [Q96N95-2]
NP_665699.1. NM_145756.2. [Q96N95-3]
XP_006722495.1. XM_006722432.3. [Q96N95-1]
UniGeneiHs.351005.

Genome annotation databases

EnsembliENST00000306346; ENSP00000302310; ENSG00000186496. [Q96N95-3]
ENST00000586687; ENSP00000467275; ENSG00000186496. [Q96N95-2]
ENST00000589332; ENSP00000466500; ENSG00000186496. [Q96N95-1]
GeneIDi252884.
KEGGihsa:252884.
UCSCiuc010xcf.1. human. [Q96N95-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492004 mRNA. Translation: AAM09559.3.
AF533251 mRNA. Translation: AAM95992.1.
AK055775 mRNA. Translation: BAB71010.1.
CH471088 Genomic DNA. Translation: EAX01352.1.
BC130288 mRNA. Translation: AAI30289.1.
BC136314 mRNA. Translation: AAI36315.1.
CCDSiCCDS11913.1. [Q96N95-3]
RefSeqiNP_001309215.1. NM_001322286.1. [Q96N95-1]
NP_001309219.1. NM_001322290.1. [Q96N95-1]
NP_001309220.1. NM_001322291.1. [Q96N95-2]
NP_665699.1. NM_145756.2. [Q96N95-3]
XP_006722495.1. XM_006722432.3. [Q96N95-1]
UniGeneiHs.351005.

3D structure databases

ProteinModelPortaliQ96N95.
SMRiQ96N95. Positions 45-135, 248-329.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128934. 14 interactions.
STRINGi9606.ENSP00000302310.

PTM databases

iPTMnetiQ96N95.
PhosphoSiteiQ96N95.

Polymorphism and mutation databases

BioMutaiZNF396.
DMDMi38258950.

Proteomic databases

PaxDbiQ96N95.
PeptideAtlasiQ96N95.
PRIDEiQ96N95.
TopDownProteomicsiQ96N95-3. [Q96N95-3]

Protocols and materials databases

DNASUi252884.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306346; ENSP00000302310; ENSG00000186496. [Q96N95-3]
ENST00000586687; ENSP00000467275; ENSG00000186496. [Q96N95-2]
ENST00000589332; ENSP00000466500; ENSG00000186496. [Q96N95-1]
GeneIDi252884.
KEGGihsa:252884.
UCSCiuc010xcf.1. human. [Q96N95-1]

Organism-specific databases

CTDi252884.
GeneCardsiZNF396.
HGNCiHGNC:18824. ZNF396.
HPAiHPA006686.
MIMi609600. gene.
neXtProtiNX_Q96N95.
PharmGKBiPA38697.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000118881.
HOGENOMiHOG000234619.
HOVERGENiHBG018163.
InParanoidiQ96N95.
KOiK09230.
OMAiYACDECA.
OrthoDBiEOG091G09O3.
PhylomeDBiQ96N95.
TreeFamiTF338304.

Miscellaneous databases

GenomeRNAii252884.
PROiQ96N95.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000186496.
CleanExiHS_ZNF396.
ExpressionAtlasiQ96N95. baseline and differential.
GenevisibleiQ96N95. HS.

Family and domain databases

Gene3Di3.30.160.60. 3 hits.
InterProiIPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF02023. SCAN. 1 hit.
PF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 3 hits.
[Graphical view]
SUPFAMiSSF47353. SSF47353. 1 hit.
PROSITEiPS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN396_HUMAN
AccessioniPrimary (citable) accession number: Q96N95
Secondary accession number(s): A1L3V0, Q8NF98, Q8TD80
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: October 31, 2003
Last modified: September 7, 2016
This is version 143 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.