Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 396

Gene

ZNF396

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1 and isoform 2 act as DNA-dependent transcriptional repressors.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri251 – 273C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri279 – 301C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri307 – 329C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 396
Alternative name(s):
Zinc finger and SCAN domain-containing protein 14
Gene namesi
Name:ZNF396
Synonyms:ZSCAN14
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

EuPathDBiHostDB:ENSG00000186496.10
HGNCiHGNC:18824 ZNF396
MIMi609600 gene
neXtProtiNX_Q96N95

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186496
PharmGKBiPA38697

Polymorphism and mutation databases

BioMutaiZNF396
DMDMi38258950

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000475631 – 335Zinc finger protein 396Add BLAST335

Proteomic databases

MaxQBiQ96N95
PaxDbiQ96N95
PeptideAtlasiQ96N95
PRIDEiQ96N95
ProteomicsDBi77486
77487 [Q96N95-2]
77488 [Q96N95-3]
TopDownProteomicsiQ96N95-3 [Q96N95-3]

PTM databases

iPTMnetiQ96N95
PhosphoSitePlusiQ96N95

Expressioni

Tissue specificityi

Expressed strongly in liver, moderately in skeletal muscle and weakly in kidney, pancreas, spleen and prostate.1 Publication

Gene expression databases

BgeeiENSG00000186496
CleanExiHS_ZNF396
ExpressionAtlasiQ96N95 baseline and differential
GenevisibleiQ96N95 HS

Organism-specific databases

HPAiHPA006686

Interactioni

Subunit structurei

Isoforms 1 and 2 can both homo- and hetero-associate.1 Publication

GO - Molecular functioni

  • protein heterodimerization activity Source: UniProtKB
  • protein homodimerization activity Source: UniProtKB

Protein-protein interaction databases

BioGridi128934, 14 interactors
IntActiQ96N95, 4 interactors
STRINGi9606.ENSP00000302310

Structurei

3D structure databases

ProteinModelPortaliQ96N95
SMRiQ96N95
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 134SCAN boxPROSITE-ProRule annotationAdd BLAST83

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri251 – 273C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri279 – 301C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri307 – 329C2H2-type 3PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00760000118881
HOGENOMiHOG000234619
HOVERGENiHBG018163
InParanoidiQ96N95
KOiK09230
OMAiYACDECA
OrthoDBiEOG091G09O3
PhylomeDBiQ96N95
TreeFamiTF338304

Family and domain databases

CDDicd07936 SCAN, 1 hit
Gene3Di1.10.4020.10, 1 hit
InterProiView protein in InterPro
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF02023 SCAN, 1 hit
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 3 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96N95-1) [UniParc]FASTAAdd to basket
Also known as: ZNF396-fu

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSAKLGKSSS LLTQTSEECN GILTEKMEEE EQTCDPDSSL HWSSSYSPET
60 70 80 90 100
FRQQFRQFGY QDSPGPHEAL SRLWELCHLW LRPEVHTKEQ ILELLVLEQF
110 120 130 140 150
LAILPKELQA WVQKHHPENG EETVTMLEDV ERELDGPKQI FFGRRKDMIA
160 170 180 190 200
EKLAPSEITE ELPSSQLMPV KKQLQGASWE LQSLRPHDED IKTTNVKSAS
210 220 230 240 250
RQKTSLGIEL HCNVSNILHM NGSQSSTYRG TYEQDGRFEK RQGNPSWKKQ
260 270 280 290 300
QKCDECGKIF SQSSALILHQ RIHSGKKPYA CDECAKAFSR SAILIQHRRT
310 320 330
HTGEKPYKCH DCGKAFSQSS NLFRHRKRHI RKKVP
Length:335
Mass (Da):38,612
Last modified:October 31, 2003 - v2
Checksum:i2EC72390016E3E4F
GO
Isoform 2 (identifier: Q96N95-2) [UniParc]FASTAAdd to basket
Also known as: Truncated, ZNF396-nf

The sequence of this isoform differs from the canonical sequence as follows:
     188-210: DEDIKTTNVKSASRQKTSLGIEL → GEGAGFSSCWKVWGPSAHHTHLS
     211-335: Missing.

Show »
Length:210
Mass (Da):24,061
Checksum:i59B01660963377C1
GO
Isoform 3 (identifier: Q96N95-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     303-335: GEKPYKCHDCGKAFSQSSNLFRHRKRHIRKKVP → DSKYEHAIAEAQKNMYFKTRLKCPRSLSGGR

Note: No experimental confirmation available.
Show »
Length:333
Mass (Da):38,258
Checksum:i138811B6D0533261
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti125T → A in AAM09559 (PubMed:12801647).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057418211H → L. Corresponds to variant dbSNP:rs9963473Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_008768188 – 210DEDIK…LGIEL → GEGAGFSSCWKVWGPSAHHT HLS in isoform 2. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_006923211 – 335Missing in isoform 2. 1 PublicationAdd BLAST125
Alternative sequenceiVSP_020993303 – 335GEKPY…RKKVP → DSKYEHAIAEAQKNMYFKTR LKCPRSLSGGR in isoform 3. 2 PublicationsAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF492004 mRNA Translation: AAM09559.3
AF533251 mRNA Translation: AAM95992.1
AK055775 mRNA Translation: BAB71010.1
CH471088 Genomic DNA Translation: EAX01352.1
BC130288 mRNA Translation: AAI30289.1
BC136314 mRNA Translation: AAI36315.1
CCDSiCCDS11913.1 [Q96N95-3]
CCDS82246.1 [Q96N95-2]
CCDS82247.1 [Q96N95-1]
RefSeqiNP_001309215.1, NM_001322286.1 [Q96N95-1]
NP_001309219.1, NM_001322290.1 [Q96N95-1]
NP_001309220.1, NM_001322291.1 [Q96N95-2]
NP_665699.1, NM_145756.2 [Q96N95-3]
XP_006722495.1, XM_006722432.3 [Q96N95-1]
XP_016881176.1, XM_017025687.1 [Q96N95-1]
XP_016881177.1, XM_017025688.1 [Q96N95-1]
UniGeneiHs.351005

Genome annotation databases

EnsembliENST00000306346; ENSP00000302310; ENSG00000186496 [Q96N95-3]
ENST00000586687; ENSP00000467275; ENSG00000186496 [Q96N95-2]
ENST00000589332; ENSP00000466500; ENSG00000186496 [Q96N95-1]
GeneIDi252884
KEGGihsa:252884
UCSCiuc010xcf.1 human [Q96N95-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN396_HUMAN
AccessioniPrimary (citable) accession number: Q96N95
Secondary accession number(s): A1L3V0, Q8NF98, Q8TD80
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2002
Last sequence update: October 31, 2003
Last modified: June 20, 2018
This is version 157 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health