Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 641

Gene

ZNF641

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional activator. Activates transcriptional activities of SRE and AP-1.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167528-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 641
Gene namesi
Name:ZNF641
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:31834. ZNF641.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167528.
PharmGKBiPA142670508.

Polymorphism and mutation databases

BioMutaiZNF641.
DMDMi146328571.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002853011 – 438Zinc finger protein 641Add BLAST438

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei191PhosphoserineCombined sources1
Modified residuei426PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ96N77.
PeptideAtlasiQ96N77.
PRIDEiQ96N77.

PTM databases

iPTMnetiQ96N77.
PhosphoSitePlusiQ96N77.

Expressioni

Tissue specificityi

Highly expressed in skeletal muscle, moderate expression in heart, liver, and pancreas, lower expression in placenta, no expression seen in brain, lung, and kidney.1 Publication

Gene expression databases

BgeeiENSG00000167528.
CleanExiHS_ZNF641.
ExpressionAtlasiQ96N77. baseline and differential.
GenevisibleiQ96N77. HS.

Organism-specific databases

HPAiHPA035189.

Interactioni

Protein-protein interaction databases

BioGridi125718. 4 interactors.
IntActiQ96N77. 3 interactors.
MINTiMINT-8417747.
STRINGi9606.ENSP00000301042.

Structurei

3D structure databases

ProteinModelPortaliQ96N77.
SMRiQ96N77.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini109 – 181KRABPROSITE-ProRule annotationAdd BLAST73

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni171 – 265TransactivationAdd BLAST95

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri264 – 286C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri320 – 342C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri372 – 394C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri400 – 422C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129746.
HOGENOMiHOG000234619.
HOVERGENiHBG102979.
InParanoidiQ96N77.
KOiK09228.
OMAiKCHVCTE.
OrthoDBiEOG091G0P6J.
PhylomeDBiQ96N77.
TreeFamiTF350829.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 5 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 1 hit.
PfamiPF01352. KRAB. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96N77-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAEDRSQFG SAAEMLSEQT AALGTGWESM NVQLDGAEPQ VERGSQEERP
60 70 80 90 100
WRTVPGPLEH LCCDLEEEPQ SLQEKAQSAP WVPAIPQEGN TGDWEMAAAL
110 120 130 140 150
LAAGSQGLVT IKDVSLCFSQ EEWRSLDPSQ TDFYGEYVMQ ENCGIVVSLR
160 170 180 190 200
FPIPKLDMLS QLEGGEEQWV PDPQDLEERD ILRVTYTGDG SEHEGDTPEL
210 220 230 240 250
EAEPPRMLSS VSEDTVLWNP EHDESWDSMP SSSRGMLLGP PFLQEDSFSN
260 270 280 290 300
LLCSTEMDSL LRPHTCPQCG KQFVWGSHLA RHQQTHTGER PYSCLKCEKT
310 320 330 340 350
FGRRHHLIRH QKTHLHDKTS RCSECGKNFR CNSHLASHQR VHAEGKSCKG
360 370 380 390 400
QEVGESPGTR KRQRAPPVPK CHVCTECGKS FGRRHHLVRH WLTHTGEKPF
410 420 430
QCPRCEKSFG RKHHLDRHLL THQGQSPRNS WDRGTSVF
Length:438
Mass (Da):49,528
Last modified:May 1, 2007 - v2
Checksum:iE3873D1A84CF395D
GO
Isoform 2 (identifier: Q96N77-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     398-438: Missing.

Note: No experimental confirmation available.
Show »
Length:383
Mass (Da):43,162
Checksum:iE9E7E4F2F6B2E51E
GO
Isoform 3 (identifier: Q96N77-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.
     107-150: GLVTIKDVSL...ENCGIVVSLR → VSSASLGVSCGPITAAFVLLSHQPIDELAHMIING

Note: No experimental confirmation available.
Show »
Length:415
Mass (Da):46,525
Checksum:iA4799AF9694624B7
GO
Isoform 4 (identifier: Q96N77-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.

Note: No experimental confirmation available.
Show »
Length:424
Mass (Da):48,020
Checksum:i2ABA7BEB0C3B772D
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti26G → R in AAH18090 (PubMed:15489334).Curated1
Sequence conflicti189D → G in AAW28082 (PubMed:16343441).Curated1
Sequence conflicti189D → G in BAB71031 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032009231S → C.1 PublicationCorresponds to variant rs17851618dbSNPEnsembl.1
Natural variantiVAR_032010363Q → P.1 PublicationCorresponds to variant rs2732481dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0248671 – 14Missing in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST14
Alternative sequenceiVSP_043422107 – 150GLVTI…VVSLR → VSSASLGVSCGPITAAFVLL SHQPIDELAHMIING in isoform 3. 1 PublicationAdd BLAST44
Alternative sequenceiVSP_024868398 – 438Missing in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY842285 mRNA. Translation: AAW28082.1.
AK055857 mRNA. Translation: BAB71031.1.
AK092740 mRNA. Translation: BAG52605.1.
AK298064 mRNA. Translation: BAG60357.1.
AC024257 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57982.1.
BC018090 mRNA. Translation: AAH18090.2.
AL713659 mRNA. Translation: CAD28468.1.
CCDSiCCDS53787.1. [Q96N77-3]
CCDS53788.1. [Q96N77-4]
CCDS8763.1. [Q96N77-1]
RefSeqiNP_001166152.1. NM_001172681.1. [Q96N77-4]
NP_001166153.1. NM_001172682.1. [Q96N77-3]
NP_689533.2. NM_152320.2. [Q96N77-1]
XP_005268695.1. XM_005268638.3. [Q96N77-4]
XP_011536199.1. XM_011537897.1. [Q96N77-1]
XP_011536200.1. XM_011537898.1. [Q96N77-4]
XP_016874286.1. XM_017018797.1. [Q96N77-3]
UniGeneiHs.23492.
Hs.729288.

Genome annotation databases

EnsembliENST00000301042; ENSP00000301042; ENSG00000167528. [Q96N77-1]
ENST00000448928; ENSP00000394627; ENSG00000167528. [Q96N77-3]
ENST00000544117; ENSP00000437832; ENSG00000167528. [Q96N77-1]
ENST00000547026; ENSP00000449974; ENSG00000167528. [Q96N77-4]
GeneIDi121274.
KEGGihsa:121274.
UCSCiuc001rrn.3. human. [Q96N77-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY842285 mRNA. Translation: AAW28082.1.
AK055857 mRNA. Translation: BAB71031.1.
AK092740 mRNA. Translation: BAG52605.1.
AK298064 mRNA. Translation: BAG60357.1.
AC024257 Genomic DNA. No translation available.
CH471111 Genomic DNA. Translation: EAW57982.1.
BC018090 mRNA. Translation: AAH18090.2.
AL713659 mRNA. Translation: CAD28468.1.
CCDSiCCDS53787.1. [Q96N77-3]
CCDS53788.1. [Q96N77-4]
CCDS8763.1. [Q96N77-1]
RefSeqiNP_001166152.1. NM_001172681.1. [Q96N77-4]
NP_001166153.1. NM_001172682.1. [Q96N77-3]
NP_689533.2. NM_152320.2. [Q96N77-1]
XP_005268695.1. XM_005268638.3. [Q96N77-4]
XP_011536199.1. XM_011537897.1. [Q96N77-1]
XP_011536200.1. XM_011537898.1. [Q96N77-4]
XP_016874286.1. XM_017018797.1. [Q96N77-3]
UniGeneiHs.23492.
Hs.729288.

3D structure databases

ProteinModelPortaliQ96N77.
SMRiQ96N77.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125718. 4 interactors.
IntActiQ96N77. 3 interactors.
MINTiMINT-8417747.
STRINGi9606.ENSP00000301042.

PTM databases

iPTMnetiQ96N77.
PhosphoSitePlusiQ96N77.

Polymorphism and mutation databases

BioMutaiZNF641.
DMDMi146328571.

Proteomic databases

PaxDbiQ96N77.
PeptideAtlasiQ96N77.
PRIDEiQ96N77.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301042; ENSP00000301042; ENSG00000167528. [Q96N77-1]
ENST00000448928; ENSP00000394627; ENSG00000167528. [Q96N77-3]
ENST00000544117; ENSP00000437832; ENSG00000167528. [Q96N77-1]
ENST00000547026; ENSP00000449974; ENSG00000167528. [Q96N77-4]
GeneIDi121274.
KEGGihsa:121274.
UCSCiuc001rrn.3. human. [Q96N77-1]

Organism-specific databases

CTDi121274.
GeneCardsiZNF641.
HGNCiHGNC:31834. ZNF641.
HPAiHPA035189.
MIMi613906. gene.
neXtProtiNX_Q96N77.
OpenTargetsiENSG00000167528.
PharmGKBiPA142670508.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129746.
HOGENOMiHOG000234619.
HOVERGENiHBG102979.
InParanoidiQ96N77.
KOiK09228.
OMAiKCHVCTE.
OrthoDBiEOG091G0P6J.
PhylomeDBiQ96N77.
TreeFamiTF350829.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167528-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii121274.
PROiQ96N77.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167528.
CleanExiHS_ZNF641.
ExpressionAtlasiQ96N77. baseline and differential.
GenevisibleiQ96N77. HS.

Family and domain databases

CDDicd07765. KRAB_A-box. 1 hit.
Gene3Di3.30.160.60. 5 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR001909. KRAB.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 1 hit.
PfamiPF01352. KRAB. 1 hit.
[Graphical view]
SMARTiSM00349. KRAB. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN641_HUMAN
AccessioniPrimary (citable) accession number: Q96N77
Secondary accession number(s): B3KS43
, B4DNU5, Q8TCQ7, Q8WVE1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: November 2, 2016
This is version 131 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.