Q96N76 (HUTU_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 89.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Urocanate hydratase Short name=Urocanase EC=4.2.1.49 Alternative name(s): Imidazolonepropionate hydrolase | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 676 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | 3-(5-oxo-4,5-dihydro-3H-imidazol-4-yl)propanoate = urocanate + H2O. Ref.5 |
| Cofactor | NAD By similarity. |
| Pathway | |
| Involvement in disease | Urocanase deficiency (UROD) [MIM:276880]: An inborn error of histidine metabolism resulting in urocanic aciduria and neurological manifestations including mental retardation, ataxia, episodic aggressive behavior or exaggerated affection-seeking. |
| Sequence similarities | Belongs to the urocanase family. |
| Sequence caution | The sequence BAD38651.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Histidine metabolism |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Ligand | NAD |
| Molecular function | Lyase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | histidine catabolic process Inferred from mutant phenotype Ref.5. Source: BHF-UCL histidine catabolic process to glutamate and formamideInferred from electronic annotation. Source: UniProtKB-UniPathway histidine catabolic process to glutamate and formateInferred from electronic annotation. Source: UniProtKB-UniPathway |
| Cellular_component | cytosol Inferred from direct assay Ref.5. Source: BHF-UCL |
| Molecular_function | urocanate hydratase activity Inferred from direct assay Ref.5. Source: BHF-UCL |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96N76-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96N76-2) The sequence of this isoform differs from the canonical sequence as follows: 300-300: L → LRVLQLGLQQALGWAGLPAALGLCVLSCFVNLAPLGEGRCLAPSGFSRPLLGAPVLLLCPS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 676 | 676 | Urocanate hydratase | PRO_0000207374 | |||||
Natural variations | |||||||||
| Alternative sequence | 300 | 1 | L → LRVLQLGLQQALGWAGLPAA LGLCVLSCFVNLAPLGEGRC LAPSGFSRPLLGAPVLLLCP S in isoform 2. | VSP_045422 | |||||
| Natural variant | 70 | 1 | L → P in UROD. Ref.5 | VAR_062649 | |||||
| Natural variant | 188 | 1 | R → W. Corresponds to variant rs34488036 [ dbSNP | Ensembl ]. | VAR_034000 | |||||
| Natural variant | 311 | 1 | S → T. Corresponds to variant rs35062810 [ dbSNP | Ensembl ]. | VAR_034001 | |||||
| Natural variant | 429 | 1 | R → C. Corresponds to variant rs9871671 [ dbSNP | Ensembl ]. | VAR_042732 | |||||
| Natural variant | 450 | 1 | R → C in UROD; loss of activity. Ref.5 | VAR_060221 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas." Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A. Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [3] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Mutations in the urocanase gene UROC1 are associated with urocanic aciduria." Espinos C., Pineda M., Martinez-Rubio D., Lupo V., Ormazabal A., Vilaseca M.A., Spaapen L.J.M., Palau F., Artuch R. J. Med. Genet. 46:407-411(2009) [PubMed] [Europe PMC] [Abstract] Cited for: CATALYTIC ACTIVITY, VARIANTS UROD PRO-70 AND CYS-450. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB075869 mRNA. Translation: BAD38651.1. Different initiation. AK055862 mRNA. Translation: BAB71032.1. AC024558 Genomic DNA. No translation available. BC115405 mRNA. Translation: AAI15406.1. BC115406 mRNA. Translation: AAI15407.1. |
| IPI | IPI00043499. IPI00470790. |
| RefSeq | NP_001159446.1. NM_001165974.1. NP_653240.1. NM_144639.2. |
| UniGene | Hs.331148. |
3D structure databases | |
| ProteinModelPortal | Q96N76. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000290868. |
PTM databases | |
| PhosphoSite | Q96N76. |
Polymorphism databases | |
| DMDM | 22256789. |
Proteomic databases | |
| PaxDb | Q96N76. |
| PRIDE | Q96N76. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000290868; ENSP00000290868; ENSG00000159650. ENST00000383579; ENSP00000373073; ENSG00000159650. |
| GeneID | 131669. |
| KEGG | hsa:131669. |
| UCSC | uc003eiz.2. human. |
Organism-specific databases | |
| CTD | 131669. |
| GeneCards | GC03M126200. |
| HGNC | HGNC:26444. UROC1. |
| HPA | HPA036253. |
| MIM | 276880. phenotype. 613012. gene. |
| neXtProt | NX_Q96N76. |
| Orphanet | 210128. Urocanic aciduria. |
| PharmGKB | PA134879207. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2987. |
| HOGENOM | HOG000237607. |
| HOVERGEN | HBG031614. |
| KO | K01712. |
| OrthoDB | EOG4Q84X1. |
| PhylomeDB | Q96N76. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00379; UER00550. |
Gene expression databases | |
| ArrayExpress | Q96N76. |
| Bgee | Q96N76. |
| CleanEx | HS_UROC1. |
| Genevestigator | Q96N76. |
| GermOnline | ENSG00000159650. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000193. Urocanase. IPR023636. Urocanase_CS. IPR023637. Urocanase_dom. [Graphical view] |
| Pfam | PF01175. Urocanase. 1 hit. [Graphical view] |
| PIRSF | PIRSF001423. Urocanate_hydrat. 1 hit. |
| SUPFAM | SSF111326. Urocanase. 1 hit. |
| PROSITE | PS01233. UROCANASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 131669. |
| NextBio | 82958. |
| SOURCE | Search... |
Entry information
| Entry name | HUTU_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96N76 Secondary accession number(s): E9PE13, Q14C64, Q68CJ7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
