SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96N67

- DOCK7_HUMAN

UniProt

Q96N67 - DOCK7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Dedicator of cytokinesis protein 7
Gene
DOCK7, KIAA1771
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. Does not have a GEF activity for CDC42. Required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.1 Publication

GO - Molecular functioni

  1. Rac GTPase binding Source: BHF-UCL
  2. guanyl-nucleotide exchange factor activity Source: UniProtKB-KW

GO - Biological processi

  1. activation of Rac GTPase activity Source: BHF-UCL
  2. axonogenesis Source: BHF-UCL
  3. establishment of neuroblast polarity Source: BHF-UCL
  4. microtubule cytoskeleton organization Source: BHF-UCL
  5. neuron projection development Source: BHF-UCL
  6. pigmentation Source: Ensembl
  7. positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
  8. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Guanine-nucleotide releasing factor

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 7
Gene namesi
Name:DOCK7
Synonyms:KIAA1771
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:19190. DOCK7.

Subcellular locationi

Cell projectionaxon
Note: Enriched in the developing axons of hippocampal neurons.1 Publication

GO - Cellular componenti

  1. axon Source: BHF-UCL
  2. basal part of cell Source: BHF-UCL
  3. growth cone Source: BHF-UCL
  4. neuron projection Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Cell projection

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134872825.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21402140Dedicator of cytokinesis protein 7
PRO_0000189995Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei28 – 281Phosphoserine1 Publication
Modified residuei30 – 301Phosphoserine2 Publications
Modified residuei180 – 1801Phosphoserine3 Publications
Modified residuei182 – 1821Phosphoserine2 Publications
Modified residuei882 – 8821Phosphoserine1 Publication
Modified residuei888 – 8881Phosphoserine1 Publication
Modified residuei896 – 8961Phosphoserine1 Publication
Modified residuei900 – 9001Phosphoserine2 Publications
Modified residuei905 – 9051Phosphoserine1 Publication
Modified residuei907 – 9071Phosphothreonine2 Publications
Modified residuei909 – 9091Phosphothreonine1 Publication
Modified residuei910 – 9101Phosphoserine2 Publications
Modified residuei1383 – 13831Phosphoserine2 Publications
Modified residuei1430 – 14301Phosphoserine1 Publication
Modified residuei1432 – 14321Phosphoserine1 Publication
Modified residuei1438 – 14381Phosphoserine1 Publication
Modified residuei1962 – 19621N6-acetyllysine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ96N67.
PaxDbiQ96N67.
PRIDEiQ96N67.

PTM databases

PhosphoSiteiQ96N67.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

ArrayExpressiQ96N67.
BgeeiQ96N67.
CleanExiHS_DOCK7.
GenevestigatoriQ96N67.

Organism-specific databases

HPAiHPA008607.

Interactioni

Subunit structurei

Interacts with TSC1. Interacts with nucleotide-free RAC1 and RAC3.2 Publications

Protein-protein interaction databases

BioGridi124527. 35 interactions.
IntActiQ96N67. 30 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ96N67.
SMRiQ96N67. Positions 561-729, 1682-2113.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini561 – 727167DHR-1
Add
BLAST
Domaini1678 – 2114437DHR-2
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili365 – 39531 Reviewed prediction
Add
BLAST
Coiled coili2086 – 211227 Reviewed prediction
Add
BLAST

Domaini

The DHR-2 domain mediates GEF activity.

Sequence similaritiesi

Belongs to the DOCK family.
Contains 1 DHR-1 domain.
Contains 1 DHR-2 domain.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG242127.
HOVERGENiHBG051390.
OMAiYIHYVFR.
PhylomeDBiQ96N67.
TreeFamiTF313629.

Family and domain databases

InterProiIPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
[Graphical view]
PANTHERiPTHR23317. PTHR23317. 1 hit.
PfamiPF06920. Ded_cyto. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
[Graphical view]
PROSITEiPS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96N67-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAERRAFAQK ISRTVAAEVR KQISGQYSGS PQLLKNLNIV GNISHHTTVP     50
LTEAVDPVDL EDYLITHPLA VDSGPLRDLI EFPPDDIEVV YSPRDCRTLV 100
SAVPEESEMD PHVRDCIRSY TEDWAIVIRK YHKLGTGFNP NTLDKQKERQ 150
KGLPKQVFES DEAPDGNSYQ DDQDDLKRRS MSIDDTPRGS WACSIFDLKN 200
SLPDALLPNL LDRTPNEEID RQNDDQRKSN RHKELFALHP SPDEEEPIER 250
LSVPDIPKEH FGQRLLVKCL SLKFEIEIEP IFASLALYDV KEKKKISENF 300
YFDLNSEQMK GLLRPHVPPA AITTLARSAI FSITYPSQDV FLVIKLEKVL 350
QQGDIGECAE PYMIFKEADA TKNKEKLEKL KSQADQFCQR LGKYRMPFAW 400
TAIHLMNIVS SAGSLERDST EVEISTGERK GSWSERRNSS IVGRRSLERT 450
TSGDDACNLT SFRPATLTVT NFFKQEGDRL SDEDLYKFLA DMRRPSSVLR 500
RLRPITAQLK IDISPAPENP HYCLTPELLQ VKLYPDSRVR PTREILEFPA 550
RDVYVPNTTY RNLLYIYPQS LNFANRQGSA RNITVKVQFM YGEDPSNAMP 600
VIFGKSSCSE FSKEAYTAVV YHNRSPDFHE EIKVKLPATL TDHHHLLFTF 650
YHVSCQQKQN TPLETPVGYT WIPMLQNGRL KTGQFCLPVS LEKPPQAYSV 700
LSPEVPLPGM KWVDNHKGVF NVEVVAVSSI HTQDPYLDKF FALVNALDEH 750
LFPVRIGDMR IMENNLENEL KSSISALNSS QLEPVVRFLH LLLDKLILLV 800
IRPPVIAGQI VNLGQASFEA MASIINRLHK NLEGNHDQHG RNSLLASYIH 850
YVFRLPNTYP NSSSPGPGGL GGSVHYATMA RSAVRPASLN LNRSRSLSNS 900
NPDISGTPTS PDDEVRSIIG SKGLDRSNSW VNTGGPKAAP WGSNPSPSAE 950
STQAMDRSCN RMSSHTETSS FLQTLTGRLP TKKLFHEELA LQWVVCSGSV 1000
RESALQQAWF FFELMVKSMV HHLYFNDKLE APRKSRFPER FMDDIAALVS 1050
TIASDIVSRF QKDTEMVERL NTSLAFFLND LLSVMDRGFV FSLIKSCYKQ 1100
VSSKLYSLPN PSVLVSLRLD FLRIICSHEH YVTLNLPCSL LTPPASPSPS 1150
VSSATSQSSG FSTNVQDQKI ANMFELSVPF RQQHYLAGLV LTELAVILDP 1200
DAEGLFGLHK KVINMVHNLL SSHDSDPRYS DPQIKARVAM LYLPLIGIIM 1250
ETVPQLYDFT ETHNQRGRPI CIATDDYESE SGSMISQTVA MAIAGTSVPQ 1300
LTRPGSFLLT STSGRQHTTF SAESSRSLLI CLLWVLKNAD ETVLQKWFTD 1350
LSVLQLNRLL DLLYLCVSCF EYKGKKVFER MNSLTFKKSK DMRAKLEEAI 1400
LGSIGARQEM VRRSRGQLGT YTIASPPERS PSGSAFGSQE NLRWRKDMTH 1450
WRQNTEKLDK SRAEIEHEAL IDGNLATEAN LIILDTLEIV VQTVSVTESK 1500
ESILGGVLKV LLHSMACNQS AVYLQHCFAT QRALVSKFPE LLFEEETEQC 1550
ADLCLRLLRH CSSSIGTIRS HASASLYLLM RQNFEIGNNF ARVKMQVTMS 1600
LSSLVGTSQN FNEEFLRRSL KTILTYAEED LELRETTFPD QVQDLVFNLH 1650
MILSDTVKMK EHQEDPEMLI DLMYRIAKGY QTSPDLRLTW LQNMAGKHSE 1700
RSNHAEAAQC LVHSAALVAE YLSMLEDRKY LPVGCVTFQN ISSNVLEESA 1750
VSDDVVSPDE EGICSGKYFT ESGLVGLLEQ AAASFSMAGM YEAVNEVYKV 1800
LIPIHEANRD AKKLSTIHGK LQEAFSKIVH QSTGWERMFG TYFRVGFYGT 1850
KFGDLDEQEF VYKEPAITKL AEISHRLEGF YGERFGEDVV EVIKDSNPVD 1900
KCKLDPNKAY IQITYVEPYF DTYEMKDRIT YFDKNYNLRR FMYCTPFTLD 1950
GRAHGELHEQ FKRKTILTTS HAFPYIKTRV NVTHKEEIIL TPIEVAIEDM 2000
QKKTQELAFA THQDPADPKM LQMVLQGSVG TTVNQGPLEV AQVFLSEIPS 2050
DPKLFRHHNK LRLCFKDFTK RCEDALRKNK SLIGPDQKEY QRELERNYHR 2100
LKEALQPLIN RKIPQLYKAV LPVTCHRDSF SRMSLRKMDL 2140
Length:2,140
Mass (Da):242,561
Last modified:January 9, 2007 - v4
Checksum:iA14857DCB9C3AE6E
GO
Isoform 2 (identifier: Q96N67-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1419-1427: Missing.
     1832-1836: STGWE → DGK

Note: Contains a phosphoserine at position 1429. Contains a phosphoserine at position 1421. Contains a phosphoserine at position 1425.

Show »
Length:2,129
Mass (Da):241,412
Checksum:i56C741287C8296C4
GO
Isoform 3 (identifier: Q96N67-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.
     1419-1427: Missing.

Note: Contains a phosphoserine at position 1398. Contains a phosphoserine at position 1390. Contains a phosphoserine at position 1394.

Show »
Length:2,100
Mass (Da):238,534
Checksum:i4A44093C2074BD4B
GO
Isoform 4 (identifier: Q96N67-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.
     1419-1427: Missing.
     1832-1836: STGWE → DGK

Note: Contains a phosphoserine at position 1398. Contains a phosphoserine at position 1390. Contains a phosphoserine at position 1394.

Show »
Length:2,098
Mass (Da):238,274
Checksum:iA768EB92CB1CDB3D
GO
Isoform 5 (identifier: Q96N67-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     923-953: Missing.

Show »
Length:2,109
Mass (Da):239,422
Checksum:i0171AA19EEB3B57F
GO
Isoform 6 (identifier: Q96N67-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1419-1427: Missing.

Note: Contains a phosphoserine at position 1429. Contains a phosphoserine at position 1421. Contains a phosphoserine at position 1425.

Show »
Length:2,131
Mass (Da):241,673
Checksum:i2C21C8938ACE0AD5
GO
Isoform 7 (identifier: Q96N67-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     601-632: VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEI → SPSCTHPIPTVRPLPLWCYHSIFSLLSWDFIT
     633-2140: Missing.

Note: No experimental confirmation available.

Show »
Length:632
Mass (Da):72,236
Checksum:i5CD59D3E484D8F1F
GO

Sequence cautioni

The sequence AAH16392.2 differs from that shown. Reason: Frameshift at position 1337.
The sequence ABC33725.1 differs from that shown. Reason: Frameshift at position 911.
The sequence BAB71042.1 differs from that shown. Reason: Frameshift at position 1792.
The sequence BAB70933.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAC86032.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti824 – 8241I → T.
Corresponds to variant rs35400360 [ dbSNP | Ensembl ].
VAR_057524

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei601 – 63232VIFGK…FHEEI → SPSCTHPIPTVRPLPLWCYH SIFSLLSWDFIT in isoform 7.
VSP_054534Add
BLAST
Alternative sequencei633 – 21401508Missing in isoform 7.
VSP_054535Add
BLAST
Alternative sequencei923 – 95331Missing in isoform 3, isoform 4 and isoform 5.
VSP_012440Add
BLAST
Alternative sequencei1419 – 14279Missing in isoform 2, isoform 3, isoform 4 and isoform 6.
VSP_022240
Alternative sequencei1832 – 18365STGWE → DGK in isoform 2 and isoform 4.
VSP_007707

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti750 – 7501H → R in BAC86032. 1 Publication
Sequence conflicti1440 – 14401E → G in BAC86032. 1 Publication
Sequence conflicti1520 – 15201S → N in BAB70933. 1 Publication
Sequence conflicti1521 – 15211A → V in BAC86032. 1 Publication
Sequence conflicti1639 – 16391P → L in BAC86032. 1 Publication
Sequence conflicti1859 – 18591E → K in BAB70933. 1 Publication
Sequence conflicti1908 – 19081K → T in BAB71042. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ341187 mRNA. Translation: ABC68221.1.
AK055401 mRNA. Translation: BAB70917.1.
AK055493 mRNA. Translation: BAB70933.1. Different initiation.
AK055905 mRNA. Translation: BAB71042.1. Frameshift.
AK125049 mRNA. Translation: BAC86032.1. Different initiation.
AK292640 mRNA. Translation: BAF85329.1.
AL451044
, AC096946, AC103923, AL138847 Genomic DNA. Translation: CAI13104.1.
AL451044, AC096946 Genomic DNA. Translation: CAI13105.1.
AL138847
, AC096946, AC103923, AL451044 Genomic DNA. Translation: CAI22995.1.
CH471059 Genomic DNA. Translation: EAX06582.1.
DQ309763 mRNA. Translation: ABC33725.1. Frameshift.
DQ118679 mRNA. Translation: AAZ38451.1.
DQ118680 mRNA. Translation: AAZ38452.1.
AB051558 mRNA. Translation: BAB21862.1.
BC016392 mRNA. Translation: AAH16392.2. Frameshift.
CCDSiCCDS30734.1. [Q96N67-5]
CCDS60156.1. [Q96N67-2]
CCDS60157.1. [Q96N67-7]
RefSeqiNP_001258928.1. NM_001271999.1. [Q96N67-2]
NP_001258929.1. NM_001272000.1. [Q96N67-3]
NP_001258930.1. NM_001272001.1. [Q96N67-4]
NP_001258931.1. NM_001272002.1. [Q96N67-7]
NP_212132.2. NM_033407.3. [Q96N67-5]
XP_005271349.1. XM_005271292.1. [Q96N67-6]
UniGeneiHs.744927.

Genome annotation databases

EnsembliENST00000251157; ENSP00000251157; ENSG00000116641. [Q96N67-2]
ENST00000340370; ENSP00000340742; ENSG00000116641. [Q96N67-5]
ENST00000404627; ENSP00000384446; ENSG00000116641.
GeneIDi85440.
KEGGihsa:85440.
UCSCiuc001dam.3. human. [Q96N67-6]
uc001dan.4. human. [Q96N67-3]
uc001dao.4. human. [Q96N67-4]
uc001dap.4. human. [Q96N67-5]
uc001daq.4. human. [Q96N67-2]
uc009wah.2. human.

Polymorphism databases

DMDMi122065170.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ341187 mRNA. Translation: ABC68221.1 .
AK055401 mRNA. Translation: BAB70917.1 .
AK055493 mRNA. Translation: BAB70933.1 . Different initiation.
AK055905 mRNA. Translation: BAB71042.1 . Frameshift.
AK125049 mRNA. Translation: BAC86032.1 . Different initiation.
AK292640 mRNA. Translation: BAF85329.1 .
AL451044
, AC096946 , AC103923 , AL138847 Genomic DNA. Translation: CAI13104.1 .
AL451044 , AC096946 Genomic DNA. Translation: CAI13105.1 .
AL138847
, AC096946 , AC103923 , AL451044 Genomic DNA. Translation: CAI22995.1 .
CH471059 Genomic DNA. Translation: EAX06582.1 .
DQ309763 mRNA. Translation: ABC33725.1 . Frameshift.
DQ118679 mRNA. Translation: AAZ38451.1 .
DQ118680 mRNA. Translation: AAZ38452.1 .
AB051558 mRNA. Translation: BAB21862.1 .
BC016392 mRNA. Translation: AAH16392.2 . Frameshift.
CCDSi CCDS30734.1. [Q96N67-5 ]
CCDS60156.1. [Q96N67-2 ]
CCDS60157.1. [Q96N67-7 ]
RefSeqi NP_001258928.1. NM_001271999.1. [Q96N67-2 ]
NP_001258929.1. NM_001272000.1. [Q96N67-3 ]
NP_001258930.1. NM_001272001.1. [Q96N67-4 ]
NP_001258931.1. NM_001272002.1. [Q96N67-7 ]
NP_212132.2. NM_033407.3. [Q96N67-5 ]
XP_005271349.1. XM_005271292.1. [Q96N67-6 ]
UniGenei Hs.744927.

3D structure databases

ProteinModelPortali Q96N67.
SMRi Q96N67. Positions 561-729, 1682-2113.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124527. 35 interactions.
IntActi Q96N67. 30 interactions.

PTM databases

PhosphoSitei Q96N67.

Polymorphism databases

DMDMi 122065170.

Proteomic databases

MaxQBi Q96N67.
PaxDbi Q96N67.
PRIDEi Q96N67.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000251157 ; ENSP00000251157 ; ENSG00000116641 . [Q96N67-2 ]
ENST00000340370 ; ENSP00000340742 ; ENSG00000116641 . [Q96N67-5 ]
ENST00000404627 ; ENSP00000384446 ; ENSG00000116641 .
GeneIDi 85440.
KEGGi hsa:85440.
UCSCi uc001dam.3. human. [Q96N67-6 ]
uc001dan.4. human. [Q96N67-3 ]
uc001dao.4. human. [Q96N67-4 ]
uc001dap.4. human. [Q96N67-5 ]
uc001daq.4. human. [Q96N67-2 ]
uc009wah.2. human.

Organism-specific databases

CTDi 85440.
GeneCardsi GC01M062920.
HGNCi HGNC:19190. DOCK7.
HPAi HPA008607.
neXtProti NX_Q96N67.
PharmGKBi PA134872825.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG242127.
HOVERGENi HBG051390.
OMAi YIHYVFR.
PhylomeDBi Q96N67.
TreeFami TF313629.

Enzyme and pathway databases

Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

ChiTaRSi DOCK7. human.
GeneWikii Dock7.
GenomeRNAii 85440.
NextBioi 76016.
PROi Q96N67.

Gene expression databases

ArrayExpressi Q96N67.
Bgeei Q96N67.
CleanExi HS_DOCK7.
Genevestigatori Q96N67.

Family and domain databases

InterProi IPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
[Graphical view ]
PANTHERi PTHR23317. PTHR23317. 1 hit.
Pfami PF06920. Ded_cyto. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
[Graphical view ]
PROSITEi PS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The Rac activator DOCK7 regulates neuronal polarity through local phosphorylation of stathmin/Op18."
    Watabe-Uchida M., John K.A., Janas J.A., Newey S.E., Van Aelst L.
    Neuron 51:727-739(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH RAC1 AND RAC3, FUNCTION, SUBCELLULAR LOCATION.
    Tissue: Fetal brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 830-2140 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1156-2140 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 585-2140 (ISOFORM 3).
    Tissue: Brain, Mesangial cell, Thalamus and Thymus.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Molecular characterization of human Dock7."
    Yamauchi J., Miyamoto Y., Takashima S., Tanoue A.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 109-2140 (ISOFORMS 3 AND 4).
    Tissue: Brain.
  6. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 830-2140 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1332-2140 (ISOFORM 2).
    Tissue: Ovary.
  8. "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity."
    Cote J.-F., Vuori K.
    J. Cell Sci. 115:4901-4913(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NOMENCLATURE.
  9. Cited for: INTERACTION WITH TSC1, IDENTIFICATION BY MASS SPECTROMETRY.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1429 (ISOFORMS 2 AND 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1398 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-30; SER-180; SER-182; SER-882; SER-888; SER-900; THR-907; SER-910; SER-1383 AND SER-1432, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1421; SER-1425 AND SER-1429 (ISOFORMS 2 AND 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1390; SER-1394 AND SER-1398 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-180; SER-896; SER-900; SER-905; THR-907; THR-909; SER-910 AND SER-1438, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  15. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1962, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28; SER-30; SER-180; SER-182 AND SER-1430, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1383, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDOCK7_HUMAN
AccessioniPrimary (citable) accession number: Q96N67
Secondary accession number(s): Q00M63
, Q2PPY7, Q45RE8, Q45RE9, Q5T1B9, Q5T1C0, Q6ZV32, Q8TB82, Q96NG6, Q96NI0, Q9C092
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: January 9, 2007
Last modified: September 3, 2014
This is version 111 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi