Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96N67

- DOCK7_HUMAN

UniProt

Q96N67 - DOCK7_HUMAN

Protein

Dedicator of cytokinesis protein 7

Gene

DOCK7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 4 (09 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. Does not have a GEF activity for CDC42. Required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.1 Publication

    GO - Molecular functioni

    1. guanyl-nucleotide exchange factor activity Source: UniProtKB-KW
    2. Rac GTPase binding Source: BHF-UCL

    GO - Biological processi

    1. activation of Rac GTPase activity Source: BHF-UCL
    2. axonogenesis Source: BHF-UCL
    3. establishment of neuroblast polarity Source: BHF-UCL
    4. microtubule cytoskeleton organization Source: BHF-UCL
    5. neuron projection development Source: BHF-UCL
    6. pigmentation Source: Ensembl
    7. positive regulation of peptidyl-serine phosphorylation Source: BHF-UCL
    8. small GTPase mediated signal transduction Source: InterPro

    Keywords - Molecular functioni

    Developmental protein, Guanine-nucleotide releasing factor

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dedicator of cytokinesis protein 7
    Gene namesi
    Name:DOCK7
    Synonyms:KIAA1771
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:19190. DOCK7.

    Subcellular locationi

    Cell projectionaxon 1 Publication
    Note: Enriched in the developing axons of hippocampal neurons.

    GO - Cellular componenti

    1. axon Source: BHF-UCL
    2. basal part of cell Source: BHF-UCL
    3. growth cone Source: BHF-UCL
    4. neuron projection Source: BHF-UCL

    Keywords - Cellular componenti

    Cell projection

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134872825.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 21402140Dedicator of cytokinesis protein 7PRO_0000189995Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei28 – 281Phosphoserine1 Publication
    Modified residuei30 – 301Phosphoserine2 Publications
    Modified residuei180 – 1801Phosphoserine3 Publications
    Modified residuei182 – 1821Phosphoserine2 Publications
    Modified residuei882 – 8821Phosphoserine1 Publication
    Modified residuei888 – 8881Phosphoserine1 Publication
    Modified residuei896 – 8961Phosphoserine1 Publication
    Modified residuei900 – 9001Phosphoserine2 Publications
    Modified residuei905 – 9051Phosphoserine1 Publication
    Modified residuei907 – 9071Phosphothreonine2 Publications
    Modified residuei909 – 9091Phosphothreonine1 Publication
    Modified residuei910 – 9101Phosphoserine2 Publications
    Modified residuei1383 – 13831Phosphoserine2 Publications
    Modified residuei1430 – 14301Phosphoserine1 Publication
    Modified residuei1432 – 14321Phosphoserine1 Publication
    Modified residuei1438 – 14381Phosphoserine1 Publication
    Modified residuei1962 – 19621N6-acetyllysine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ96N67.
    PaxDbiQ96N67.
    PRIDEiQ96N67.

    PTM databases

    PhosphoSiteiQ96N67.

    Expressioni

    Tissue specificityi

    Widely expressed.1 Publication

    Gene expression databases

    ArrayExpressiQ96N67.
    BgeeiQ96N67.
    CleanExiHS_DOCK7.
    GenevestigatoriQ96N67.

    Organism-specific databases

    HPAiHPA008607.

    Interactioni

    Subunit structurei

    Interacts with TSC1. Interacts with nucleotide-free RAC1 and RAC3.2 Publications

    Protein-protein interaction databases

    BioGridi124527. 35 interactions.
    IntActiQ96N67. 30 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96N67.
    SMRiQ96N67. Positions 561-729, 1682-2113.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini561 – 727167DHR-1Add
    BLAST
    Domaini1678 – 2114437DHR-2Add
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili365 – 39531Sequence AnalysisAdd
    BLAST
    Coiled coili2086 – 211227Sequence AnalysisAdd
    BLAST

    Domaini

    The DHR-2 domain mediates GEF activity.

    Sequence similaritiesi

    Belongs to the DOCK family.Curated
    Contains 1 DHR-1 domain.Curated
    Contains 1 DHR-2 domain.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG242127.
    HOVERGENiHBG051390.
    OMAiYIHYVFR.
    PhylomeDBiQ96N67.
    TreeFamiTF313629.

    Family and domain databases

    InterProiIPR027007. DHR-1_domain.
    IPR027357. DHR-2.
    IPR026791. DOCK.
    IPR010703. DOCK_C.
    IPR021816. DOCK_C/D_N.
    [Graphical view]
    PANTHERiPTHR23317. PTHR23317. 1 hit.
    PfamiPF06920. Ded_cyto. 1 hit.
    PF14429. DOCK-C2. 1 hit.
    PF11878. DUF3398. 1 hit.
    [Graphical view]
    PROSITEiPS51650. DHR_1. 1 hit.
    PS51651. DHR_2. 1 hit.
    [Graphical view]

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96N67-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAERRAFAQK ISRTVAAEVR KQISGQYSGS PQLLKNLNIV GNISHHTTVP     50
    LTEAVDPVDL EDYLITHPLA VDSGPLRDLI EFPPDDIEVV YSPRDCRTLV 100
    SAVPEESEMD PHVRDCIRSY TEDWAIVIRK YHKLGTGFNP NTLDKQKERQ 150
    KGLPKQVFES DEAPDGNSYQ DDQDDLKRRS MSIDDTPRGS WACSIFDLKN 200
    SLPDALLPNL LDRTPNEEID RQNDDQRKSN RHKELFALHP SPDEEEPIER 250
    LSVPDIPKEH FGQRLLVKCL SLKFEIEIEP IFASLALYDV KEKKKISENF 300
    YFDLNSEQMK GLLRPHVPPA AITTLARSAI FSITYPSQDV FLVIKLEKVL 350
    QQGDIGECAE PYMIFKEADA TKNKEKLEKL KSQADQFCQR LGKYRMPFAW 400
    TAIHLMNIVS SAGSLERDST EVEISTGERK GSWSERRNSS IVGRRSLERT 450
    TSGDDACNLT SFRPATLTVT NFFKQEGDRL SDEDLYKFLA DMRRPSSVLR 500
    RLRPITAQLK IDISPAPENP HYCLTPELLQ VKLYPDSRVR PTREILEFPA 550
    RDVYVPNTTY RNLLYIYPQS LNFANRQGSA RNITVKVQFM YGEDPSNAMP 600
    VIFGKSSCSE FSKEAYTAVV YHNRSPDFHE EIKVKLPATL TDHHHLLFTF 650
    YHVSCQQKQN TPLETPVGYT WIPMLQNGRL KTGQFCLPVS LEKPPQAYSV 700
    LSPEVPLPGM KWVDNHKGVF NVEVVAVSSI HTQDPYLDKF FALVNALDEH 750
    LFPVRIGDMR IMENNLENEL KSSISALNSS QLEPVVRFLH LLLDKLILLV 800
    IRPPVIAGQI VNLGQASFEA MASIINRLHK NLEGNHDQHG RNSLLASYIH 850
    YVFRLPNTYP NSSSPGPGGL GGSVHYATMA RSAVRPASLN LNRSRSLSNS 900
    NPDISGTPTS PDDEVRSIIG SKGLDRSNSW VNTGGPKAAP WGSNPSPSAE 950
    STQAMDRSCN RMSSHTETSS FLQTLTGRLP TKKLFHEELA LQWVVCSGSV 1000
    RESALQQAWF FFELMVKSMV HHLYFNDKLE APRKSRFPER FMDDIAALVS 1050
    TIASDIVSRF QKDTEMVERL NTSLAFFLND LLSVMDRGFV FSLIKSCYKQ 1100
    VSSKLYSLPN PSVLVSLRLD FLRIICSHEH YVTLNLPCSL LTPPASPSPS 1150
    VSSATSQSSG FSTNVQDQKI ANMFELSVPF RQQHYLAGLV LTELAVILDP 1200
    DAEGLFGLHK KVINMVHNLL SSHDSDPRYS DPQIKARVAM LYLPLIGIIM 1250
    ETVPQLYDFT ETHNQRGRPI CIATDDYESE SGSMISQTVA MAIAGTSVPQ 1300
    LTRPGSFLLT STSGRQHTTF SAESSRSLLI CLLWVLKNAD ETVLQKWFTD 1350
    LSVLQLNRLL DLLYLCVSCF EYKGKKVFER MNSLTFKKSK DMRAKLEEAI 1400
    LGSIGARQEM VRRSRGQLGT YTIASPPERS PSGSAFGSQE NLRWRKDMTH 1450
    WRQNTEKLDK SRAEIEHEAL IDGNLATEAN LIILDTLEIV VQTVSVTESK 1500
    ESILGGVLKV LLHSMACNQS AVYLQHCFAT QRALVSKFPE LLFEEETEQC 1550
    ADLCLRLLRH CSSSIGTIRS HASASLYLLM RQNFEIGNNF ARVKMQVTMS 1600
    LSSLVGTSQN FNEEFLRRSL KTILTYAEED LELRETTFPD QVQDLVFNLH 1650
    MILSDTVKMK EHQEDPEMLI DLMYRIAKGY QTSPDLRLTW LQNMAGKHSE 1700
    RSNHAEAAQC LVHSAALVAE YLSMLEDRKY LPVGCVTFQN ISSNVLEESA 1750
    VSDDVVSPDE EGICSGKYFT ESGLVGLLEQ AAASFSMAGM YEAVNEVYKV 1800
    LIPIHEANRD AKKLSTIHGK LQEAFSKIVH QSTGWERMFG TYFRVGFYGT 1850
    KFGDLDEQEF VYKEPAITKL AEISHRLEGF YGERFGEDVV EVIKDSNPVD 1900
    KCKLDPNKAY IQITYVEPYF DTYEMKDRIT YFDKNYNLRR FMYCTPFTLD 1950
    GRAHGELHEQ FKRKTILTTS HAFPYIKTRV NVTHKEEIIL TPIEVAIEDM 2000
    QKKTQELAFA THQDPADPKM LQMVLQGSVG TTVNQGPLEV AQVFLSEIPS 2050
    DPKLFRHHNK LRLCFKDFTK RCEDALRKNK SLIGPDQKEY QRELERNYHR 2100
    LKEALQPLIN RKIPQLYKAV LPVTCHRDSF SRMSLRKMDL 2140
    Length:2,140
    Mass (Da):242,561
    Last modified:January 9, 2007 - v4
    Checksum:iA14857DCB9C3AE6E
    GO
    Isoform 2 (identifier: Q96N67-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1419-1427: Missing.
         1832-1836: STGWE → DGK

    Note: Contains a phosphoserine at position 1429. Contains a phosphoserine at position 1421. Contains a phosphoserine at position 1425.

    Show »
    Length:2,129
    Mass (Da):241,412
    Checksum:i56C741287C8296C4
    GO
    Isoform 3 (identifier: Q96N67-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         923-953: Missing.
         1419-1427: Missing.

    Note: Contains a phosphoserine at position 1398. Contains a phosphoserine at position 1390. Contains a phosphoserine at position 1394.

    Show »
    Length:2,100
    Mass (Da):238,534
    Checksum:i4A44093C2074BD4B
    GO
    Isoform 4 (identifier: Q96N67-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         923-953: Missing.
         1419-1427: Missing.
         1832-1836: STGWE → DGK

    Note: Contains a phosphoserine at position 1398. Contains a phosphoserine at position 1390. Contains a phosphoserine at position 1394.

    Show »
    Length:2,098
    Mass (Da):238,274
    Checksum:iA768EB92CB1CDB3D
    GO
    Isoform 5 (identifier: Q96N67-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         923-953: Missing.

    Show »
    Length:2,109
    Mass (Da):239,422
    Checksum:i0171AA19EEB3B57F
    GO
    Isoform 6 (identifier: Q96N67-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1419-1427: Missing.

    Note: Contains a phosphoserine at position 1429. Contains a phosphoserine at position 1421. Contains a phosphoserine at position 1425.

    Show »
    Length:2,131
    Mass (Da):241,673
    Checksum:i2C21C8938ACE0AD5
    GO
    Isoform 7 (identifier: Q96N67-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         601-632: VIFGKSSCSEFSKEAYTAVVYHNRSPDFHEEI → SPSCTHPIPTVRPLPLWCYHSIFSLLSWDFIT
         633-2140: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:632
    Mass (Da):72,236
    Checksum:i5CD59D3E484D8F1F
    GO

    Sequence cautioni

    The sequence AAH16392.2 differs from that shown. Reason: Frameshift at position 1337.
    The sequence ABC33725.1 differs from that shown. Reason: Frameshift at position 911.
    The sequence BAB71042.1 differs from that shown. Reason: Frameshift at position 1792.
    The sequence BAB70933.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC86032.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti750 – 7501H → R in BAC86032. (PubMed:14702039)Curated
    Sequence conflicti1440 – 14401E → G in BAC86032. (PubMed:14702039)Curated
    Sequence conflicti1520 – 15201S → N in BAB70933. (PubMed:14702039)Curated
    Sequence conflicti1521 – 15211A → V in BAC86032. (PubMed:14702039)Curated
    Sequence conflicti1639 – 16391P → L in BAC86032. (PubMed:14702039)Curated
    Sequence conflicti1859 – 18591E → K in BAB70933. (PubMed:14702039)Curated
    Sequence conflicti1908 – 19081K → T in BAB71042. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti824 – 8241I → T.
    Corresponds to variant rs35400360 [ dbSNP | Ensembl ].
    VAR_057524

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei601 – 63232VIFGK…FHEEI → SPSCTHPIPTVRPLPLWCYH SIFSLLSWDFIT in isoform 7. 1 PublicationVSP_054534Add
    BLAST
    Alternative sequencei633 – 21401508Missing in isoform 7. 1 PublicationVSP_054535Add
    BLAST
    Alternative sequencei923 – 95331Missing in isoform 3, isoform 4 and isoform 5. 2 PublicationsVSP_012440Add
    BLAST
    Alternative sequencei1419 – 14279Missing in isoform 2, isoform 3, isoform 4 and isoform 6. 4 PublicationsVSP_022240
    Alternative sequencei1832 – 18365STGWE → DGK in isoform 2 and isoform 4. 4 PublicationsVSP_007707

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ341187 mRNA. Translation: ABC68221.1.
    AK055401 mRNA. Translation: BAB70917.1.
    AK055493 mRNA. Translation: BAB70933.1. Different initiation.
    AK055905 mRNA. Translation: BAB71042.1. Frameshift.
    AK125049 mRNA. Translation: BAC86032.1. Different initiation.
    AK292640 mRNA. Translation: BAF85329.1.
    AL451044
    , AC096946, AC103923, AL138847 Genomic DNA. Translation: CAI13104.1.
    AL451044, AC096946 Genomic DNA. Translation: CAI13105.1.
    AL138847
    , AC096946, AC103923, AL451044 Genomic DNA. Translation: CAI22995.1.
    CH471059 Genomic DNA. Translation: EAX06582.1.
    DQ309763 mRNA. Translation: ABC33725.1. Frameshift.
    DQ118679 mRNA. Translation: AAZ38451.1.
    DQ118680 mRNA. Translation: AAZ38452.1.
    AB051558 mRNA. Translation: BAB21862.1.
    BC016392 mRNA. Translation: AAH16392.2. Frameshift.
    CCDSiCCDS30734.1. [Q96N67-5]
    CCDS60156.1. [Q96N67-2]
    CCDS60157.1. [Q96N67-7]
    RefSeqiNP_001258928.1. NM_001271999.1. [Q96N67-2]
    NP_001258929.1. NM_001272000.1. [Q96N67-3]
    NP_001258930.1. NM_001272001.1. [Q96N67-4]
    NP_001258931.1. NM_001272002.1. [Q96N67-7]
    NP_212132.2. NM_033407.3. [Q96N67-5]
    XP_005271349.1. XM_005271292.1. [Q96N67-6]
    UniGeneiHs.744927.

    Genome annotation databases

    EnsembliENST00000251157; ENSP00000251157; ENSG00000116641. [Q96N67-2]
    ENST00000340370; ENSP00000340742; ENSG00000116641. [Q96N67-5]
    ENST00000404627; ENSP00000384446; ENSG00000116641. [Q96N67-7]
    GeneIDi85440.
    KEGGihsa:85440.
    UCSCiuc001dam.3. human. [Q96N67-6]
    uc001dan.4. human. [Q96N67-3]
    uc001dao.4. human. [Q96N67-4]
    uc001dap.4. human. [Q96N67-5]
    uc001daq.4. human. [Q96N67-2]
    uc009wah.2. human.

    Polymorphism databases

    DMDMi122065170.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ341187 mRNA. Translation: ABC68221.1 .
    AK055401 mRNA. Translation: BAB70917.1 .
    AK055493 mRNA. Translation: BAB70933.1 . Different initiation.
    AK055905 mRNA. Translation: BAB71042.1 . Frameshift.
    AK125049 mRNA. Translation: BAC86032.1 . Different initiation.
    AK292640 mRNA. Translation: BAF85329.1 .
    AL451044
    , AC096946 , AC103923 , AL138847 Genomic DNA. Translation: CAI13104.1 .
    AL451044 , AC096946 Genomic DNA. Translation: CAI13105.1 .
    AL138847
    , AC096946 , AC103923 , AL451044 Genomic DNA. Translation: CAI22995.1 .
    CH471059 Genomic DNA. Translation: EAX06582.1 .
    DQ309763 mRNA. Translation: ABC33725.1 . Frameshift.
    DQ118679 mRNA. Translation: AAZ38451.1 .
    DQ118680 mRNA. Translation: AAZ38452.1 .
    AB051558 mRNA. Translation: BAB21862.1 .
    BC016392 mRNA. Translation: AAH16392.2 . Frameshift.
    CCDSi CCDS30734.1. [Q96N67-5 ]
    CCDS60156.1. [Q96N67-2 ]
    CCDS60157.1. [Q96N67-7 ]
    RefSeqi NP_001258928.1. NM_001271999.1. [Q96N67-2 ]
    NP_001258929.1. NM_001272000.1. [Q96N67-3 ]
    NP_001258930.1. NM_001272001.1. [Q96N67-4 ]
    NP_001258931.1. NM_001272002.1. [Q96N67-7 ]
    NP_212132.2. NM_033407.3. [Q96N67-5 ]
    XP_005271349.1. XM_005271292.1. [Q96N67-6 ]
    UniGenei Hs.744927.

    3D structure databases

    ProteinModelPortali Q96N67.
    SMRi Q96N67. Positions 561-729, 1682-2113.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124527. 35 interactions.
    IntActi Q96N67. 30 interactions.

    PTM databases

    PhosphoSitei Q96N67.

    Polymorphism databases

    DMDMi 122065170.

    Proteomic databases

    MaxQBi Q96N67.
    PaxDbi Q96N67.
    PRIDEi Q96N67.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000251157 ; ENSP00000251157 ; ENSG00000116641 . [Q96N67-2 ]
    ENST00000340370 ; ENSP00000340742 ; ENSG00000116641 . [Q96N67-5 ]
    ENST00000404627 ; ENSP00000384446 ; ENSG00000116641 . [Q96N67-7 ]
    GeneIDi 85440.
    KEGGi hsa:85440.
    UCSCi uc001dam.3. human. [Q96N67-6 ]
    uc001dan.4. human. [Q96N67-3 ]
    uc001dao.4. human. [Q96N67-4 ]
    uc001dap.4. human. [Q96N67-5 ]
    uc001daq.4. human. [Q96N67-2 ]
    uc009wah.2. human.

    Organism-specific databases

    CTDi 85440.
    GeneCardsi GC01M062920.
    HGNCi HGNC:19190. DOCK7.
    HPAi HPA008607.
    neXtProti NX_Q96N67.
    PharmGKBi PA134872825.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG242127.
    HOVERGENi HBG051390.
    OMAi YIHYVFR.
    PhylomeDBi Q96N67.
    TreeFami TF313629.

    Enzyme and pathway databases

    Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

    Miscellaneous databases

    ChiTaRSi DOCK7. human.
    GeneWikii Dock7.
    GenomeRNAii 85440.
    NextBioi 76016.
    PROi Q96N67.

    Gene expression databases

    ArrayExpressi Q96N67.
    Bgeei Q96N67.
    CleanExi HS_DOCK7.
    Genevestigatori Q96N67.

    Family and domain databases

    InterProi IPR027007. DHR-1_domain.
    IPR027357. DHR-2.
    IPR026791. DOCK.
    IPR010703. DOCK_C.
    IPR021816. DOCK_C/D_N.
    [Graphical view ]
    PANTHERi PTHR23317. PTHR23317. 1 hit.
    Pfami PF06920. Ded_cyto. 1 hit.
    PF14429. DOCK-C2. 1 hit.
    PF11878. DUF3398. 1 hit.
    [Graphical view ]
    PROSITEi PS51650. DHR_1. 1 hit.
    PS51651. DHR_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The Rac activator DOCK7 regulates neuronal polarity through local phosphorylation of stathmin/Op18."
      Watabe-Uchida M., John K.A., Janas J.A., Newey S.E., Van Aelst L.
      Neuron 51:727-739(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH RAC1 AND RAC3, FUNCTION, SUBCELLULAR LOCATION.
      Tissue: Fetal brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 830-2140 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1156-2140 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 585-2140 (ISOFORM 3).
      Tissue: Brain, Mesangial cell, Thalamus and Thymus.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Molecular characterization of human Dock7."
      Yamauchi J., Miyamoto Y., Takashima S., Tanoue A.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 109-2140 (ISOFORMS 3 AND 4).
      Tissue: Brain.
    6. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 830-2140 (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1332-2140 (ISOFORM 2).
      Tissue: Ovary.
    8. "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity."
      Cote J.-F., Vuori K.
      J. Cell Sci. 115:4901-4913(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NOMENCLATURE.
    9. Cited for: INTERACTION WITH TSC1, IDENTIFICATION BY MASS SPECTROMETRY.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1429 (ISOFORMS 2 AND 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1398 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-30; SER-180; SER-182; SER-882; SER-888; SER-900; THR-907; SER-910; SER-1383 AND SER-1432, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1421; SER-1425 AND SER-1429 (ISOFORMS 2 AND 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1390; SER-1394 AND SER-1398 (ISOFORMS 3 AND 4), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-180; SER-896; SER-900; SER-905; THR-907; THR-909; SER-910 AND SER-1438, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    15. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-1962, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-28; SER-30; SER-180; SER-182 AND SER-1430, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    17. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1383, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiDOCK7_HUMAN
    AccessioniPrimary (citable) accession number: Q96N67
    Secondary accession number(s): Q00M63
    , Q2PPY7, Q45RE8, Q45RE9, Q5T1B9, Q5T1C0, Q6ZV32, Q8TB82, Q96NG6, Q96NI0, Q9C092
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 3, 2003
    Last sequence update: January 9, 2007
    Last modified: October 1, 2014
    This is version 112 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3