Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integral membrane protein GPR137

Gene

GPR137

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173264-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Integral membrane protein GPR137
Alternative name(s):
Transmembrane 7 superfamily member 1-like 1 protein
Gene namesi
Name:GPR137
Synonyms:C11orf4, GPR137A, TM7SF1L1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:24300. GPR137.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 31ExtracellularSequence analysisAdd BLAST31
Transmembranei32 – 52HelicalSequence analysisAdd BLAST21
Topological domaini53 – 60CytoplasmicSequence analysis8
Transmembranei61 – 81HelicalSequence analysisAdd BLAST21
Topological domaini82 – 89ExtracellularSequence analysis8
Transmembranei90 – 110HelicalSequence analysisAdd BLAST21
Topological domaini111 – 140CytoplasmicSequence analysisAdd BLAST30
Transmembranei141 – 161HelicalSequence analysisAdd BLAST21
Topological domaini162 – 175ExtracellularSequence analysisAdd BLAST14
Transmembranei176 – 196HelicalSequence analysisAdd BLAST21
Topological domaini197 – 218CytoplasmicSequence analysisAdd BLAST22
Transmembranei219 – 241HelicalSequence analysisAdd BLAST23
Topological domaini242 – 274ExtracellularSequence analysisAdd BLAST33
Transmembranei275 – 295HelicalSequence analysisAdd BLAST21
Topological domaini296 – 417CytoplasmicSequence analysisAdd BLAST122

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi56834.
OpenTargetsiENSG00000173264.
PharmGKBiPA143485482.

Polymorphism and mutation databases

BioMutaiGPR137.
DMDMi126302549.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002699961 – 417Integral membrane protein GPR137Add BLAST417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi4N-linked (GlcNAc...)Sequence analysis1
Glycosylationi257N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ96N19.
PeptideAtlasiQ96N19.
PRIDEiQ96N19.

PTM databases

iPTMnetiQ96N19.
PhosphoSitePlusiQ96N19.

Expressioni

Gene expression databases

BgeeiENSG00000173264.
CleanExiHS_GPR137.
ExpressionAtlasiQ96N19. baseline and differential.
GenevisibleiQ96N19. HS.

Organism-specific databases

HPAiHPA062871.

Interactioni

Protein-protein interaction databases

BioGridi121207. 3 interactors.
STRINGi9606.ENSP00000411827.

Structurei

3D structure databases

ProteinModelPortaliQ96N19.
SMRiQ96N19.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GPR137 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IGBD. Eukaryota.
ENOG410XQNA. LUCA.
GeneTreeiENSGT00390000008320.
HOGENOMiHOG000286020.
HOVERGENiHBG058911.
InParanoidiQ96N19.
OMAiFDRAHCE.
OrthoDBiEOG091G08XG.
PhylomeDBiQ96N19.
TreeFamiTF329003.

Family and domain databases

InterProiIPR029723. GPR137.
[Graphical view]
PANTHERiPTHR15146. PTHR15146. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96N19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESNLSGLVP AAGLVPALPP AVTLGLTAAY TTLYALLFFS VYAQLWLVLL
60 70 80 90 100
YGHKRLSYQT VFLALCLLWA ALRTTLFSFY FRDTPRANRL GPLPFWLLYC
110 120 130 140 150
CPVCLQFFTL TLMNLYFAQV VFKAKVKRRP EMSRGLLAVR GAFVGASLLF
160 170 180 190 200
LLVNVLCAVL SHRRRAQPWA LLLVRVLVSD SLFVICALSL AACLCLVARR
210 220 230 240 250
APSTSIYLEA KGTSVCQAAA MGGAMVLLYA SRACYNLTAL ALAPQSRLDT
260 270 280 290 300
FDYDWYNVSD QADLVNDLGN KGYLVFGLIL FVWELLPTTL LVGFFRVHRP
310 320 330 340 350
PQDLSTSHIL NGQVFASRSY FFDRAGHCED EGCSWEHSRG ESTRCQDQAA
360 370 380 390 400
TTTVSTPPHR RDPPPSPTEY PGPSPPHPRP LCQVCLPLLA QDPGGRGYPL
410
LWPAPCCSCH SELVPSP
Length:417
Mass (Da):46,059
Last modified:February 20, 2007 - v2
Checksum:i4059610F4B822FCA
GO
Isoform 2 (identifier: Q96N19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:396
Mass (Da):43,632
Checksum:iF95C30010101995F
GO
Isoform 3 (identifier: Q96N19-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-261: Missing.
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:346
Mass (Da):38,256
Checksum:i597CE021C5309BD0
GO
Isoform 4 (identifier: Q96N19-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):52,202
Checksum:iF2A08B174069042B
GO
Isoform 5 (identifier: Q96N19-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA
     321-417: Missing.

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):35,756
Checksum:i6829135D1AEAF215
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti254D → G in BAB71093 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0432781M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4. 1 Publication1
Alternative sequenceiVSP_022121212 – 261Missing in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_043592305 – 320STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_043593321 – 417Missing in isoform 5. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_022122344 – 417RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056094 mRNA. Translation: BAB71093.1.
AK300209 mRNA. Translation: BAG61979.1.
AK302256 mRNA. Translation: BAH13657.1.
AP001453 Genomic DNA. No translation available.
BC033920 mRNA. Translation: AAH33920.1.
BC035002 mRNA. Translation: AAH35002.1.
CCDSiCCDS53655.1. [Q96N19-4]
CCDS53656.1. [Q96N19-2]
CCDS53657.1. [Q96N19-5]
CCDS53658.1. [Q96N19-3]
CCDS8066.1. [Q96N19-1]
RefSeqiNP_001164197.1. NM_001170726.1. [Q96N19-4]
NP_001164351.1. NM_001170880.1. [Q96N19-2]
NP_001164352.1. NM_001170881.1. [Q96N19-3]
NP_001170829.1. NM_001177358.1. [Q96N19-5]
NP_064540.3. NM_020155.3. [Q96N19-1]
XP_005274157.1. XM_005274100.2. [Q96N19-1]
XP_005274158.1. XM_005274101.2. [Q96N19-1]
XP_005274159.1. XM_005274102.2. [Q96N19-1]
XP_005274161.1. XM_005274104.2. [Q96N19-1]
XP_011543471.1. XM_011545169.1. [Q96N19-1]
XP_016873503.1. XM_017018014.1. [Q96N19-2]
XP_016873504.1. XM_017018015.1. [Q96N19-2]
UniGeneiHs.523763.

Genome annotation databases

EnsembliENST00000313074; ENSP00000321698; ENSG00000173264. [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264. [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264. [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264. [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264. [Q96N19-5]
GeneIDi56834.
KEGGihsa:56834.
UCSCiuc001nzf.4. human. [Q96N19-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056094 mRNA. Translation: BAB71093.1.
AK300209 mRNA. Translation: BAG61979.1.
AK302256 mRNA. Translation: BAH13657.1.
AP001453 Genomic DNA. No translation available.
BC033920 mRNA. Translation: AAH33920.1.
BC035002 mRNA. Translation: AAH35002.1.
CCDSiCCDS53655.1. [Q96N19-4]
CCDS53656.1. [Q96N19-2]
CCDS53657.1. [Q96N19-5]
CCDS53658.1. [Q96N19-3]
CCDS8066.1. [Q96N19-1]
RefSeqiNP_001164197.1. NM_001170726.1. [Q96N19-4]
NP_001164351.1. NM_001170880.1. [Q96N19-2]
NP_001164352.1. NM_001170881.1. [Q96N19-3]
NP_001170829.1. NM_001177358.1. [Q96N19-5]
NP_064540.3. NM_020155.3. [Q96N19-1]
XP_005274157.1. XM_005274100.2. [Q96N19-1]
XP_005274158.1. XM_005274101.2. [Q96N19-1]
XP_005274159.1. XM_005274102.2. [Q96N19-1]
XP_005274161.1. XM_005274104.2. [Q96N19-1]
XP_011543471.1. XM_011545169.1. [Q96N19-1]
XP_016873503.1. XM_017018014.1. [Q96N19-2]
XP_016873504.1. XM_017018015.1. [Q96N19-2]
UniGeneiHs.523763.

3D structure databases

ProteinModelPortaliQ96N19.
SMRiQ96N19.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121207. 3 interactors.
STRINGi9606.ENSP00000411827.

PTM databases

iPTMnetiQ96N19.
PhosphoSitePlusiQ96N19.

Polymorphism and mutation databases

BioMutaiGPR137.
DMDMi126302549.

Proteomic databases

PaxDbiQ96N19.
PeptideAtlasiQ96N19.
PRIDEiQ96N19.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313074; ENSP00000321698; ENSG00000173264. [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264. [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264. [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264. [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264. [Q96N19-5]
GeneIDi56834.
KEGGihsa:56834.
UCSCiuc001nzf.4. human. [Q96N19-1]

Organism-specific databases

CTDi56834.
DisGeNETi56834.
GeneCardsiGPR137.
HGNCiHGNC:24300. GPR137.
HPAiHPA062871.
neXtProtiNX_Q96N19.
OpenTargetsiENSG00000173264.
PharmGKBiPA143485482.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGBD. Eukaryota.
ENOG410XQNA. LUCA.
GeneTreeiENSGT00390000008320.
HOGENOMiHOG000286020.
HOVERGENiHBG058911.
InParanoidiQ96N19.
OMAiFDRAHCE.
OrthoDBiEOG091G08XG.
PhylomeDBiQ96N19.
TreeFamiTF329003.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000173264-MONOMER.

Miscellaneous databases

ChiTaRSiGPR137. human.
GenomeRNAii56834.
PROiQ96N19.

Gene expression databases

BgeeiENSG00000173264.
CleanExiHS_GPR137.
ExpressionAtlasiQ96N19. baseline and differential.
GenevisibleiQ96N19. HS.

Family and domain databases

InterProiIPR029723. GPR137.
[Graphical view]
PANTHERiPTHR15146. PTHR15146. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiG137A_HUMAN
AccessioniPrimary (citable) accession number: Q96N19
Secondary accession number(s): B4DTG7
, B7Z7M1, Q4G0Y9, Q8N4K6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: February 20, 2007
Last modified: November 2, 2016
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.