Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96N19 (G137A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 75. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Integral membrane protein GPR137
Alternative name(s):
Transmembrane 7 superfamily member 1-like 1 protein
Gene names
Name:GPR137
Synonyms:C11orf4, GPR137A, TM7SF1L1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length417 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the GPR137 family.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96N19-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96N19-2)

The sequence of this isoform differs from the canonical sequence as follows:
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT
Isoform 3 (identifier: Q96N19-3)

The sequence of this isoform differs from the canonical sequence as follows:
     212-261: Missing.
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT
Isoform 4 (identifier: Q96N19-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM
Note: No experimental confirmation available.
Isoform 5 (identifier: Q96N19-5)

The sequence of this isoform differs from the canonical sequence as follows:
     305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA
     321-417: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 417417Integral membrane protein GPR137
PRO_0000269996

Regions

Topological domain1 – 3131Extracellular Potential
Transmembrane32 – 5221Helical; Potential
Topological domain53 – 608Cytoplasmic Potential
Transmembrane61 – 8121Helical; Potential
Topological domain82 – 898Extracellular Potential
Transmembrane90 – 11021Helical; Potential
Topological domain111 – 14030Cytoplasmic Potential
Transmembrane141 – 16121Helical; Potential
Topological domain162 – 17514Extracellular Potential
Transmembrane176 – 19621Helical; Potential
Topological domain197 – 21822Cytoplasmic Potential
Transmembrane219 – 24123Helical; Potential
Topological domain242 – 27433Extracellular Potential
Transmembrane275 – 29521Helical; Potential
Topological domain296 – 417122Cytoplasmic Potential

Amino acid modifications

Glycosylation41N-linked (GlcNAc...) Potential
Glycosylation2571N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence11M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4.
VSP_043278
Alternative sequence212 – 26150Missing in isoform 3.
VSP_022121
Alternative sequence305 – 32016STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5.
VSP_043592
Alternative sequence321 – 41797Missing in isoform 5.
VSP_043593
Alternative sequence344 – 41774RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3.
VSP_022122

Experimental info

Sequence conflict2541D → G in BAB71093. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 20, 2007. Version 2.
Checksum: 4059610F4B822FCA

FASTA41746,059
        10         20         30         40         50         60 
MESNLSGLVP AAGLVPALPP AVTLGLTAAY TTLYALLFFS VYAQLWLVLL YGHKRLSYQT 

        70         80         90        100        110        120 
VFLALCLLWA ALRTTLFSFY FRDTPRANRL GPLPFWLLYC CPVCLQFFTL TLMNLYFAQV 

       130        140        150        160        170        180 
VFKAKVKRRP EMSRGLLAVR GAFVGASLLF LLVNVLCAVL SHRRRAQPWA LLLVRVLVSD 

       190        200        210        220        230        240 
SLFVICALSL AACLCLVARR APSTSIYLEA KGTSVCQAAA MGGAMVLLYA SRACYNLTAL 

       250        260        270        280        290        300 
ALAPQSRLDT FDYDWYNVSD QADLVNDLGN KGYLVFGLIL FVWELLPTTL LVGFFRVHRP 

       310        320        330        340        350        360 
PQDLSTSHIL NGQVFASRSY FFDRAGHCED EGCSWEHSRG ESTRCQDQAA TTTVSTPPHR 

       370        380        390        400        410 
RDPPPSPTEY PGPSPPHPRP LCQVCLPLLA QDPGGRGYPL LWPAPCCSCH SELVPSP 

« Hide

Isoform 2 [UniParc].

Checksum: F95C30010101995F
Show »

FASTA39643,632
Isoform 3 [UniParc].

Checksum: 597CE021C5309BD0
Show »

FASTA34638,256
Isoform 4 [UniParc].

Checksum: F2A08B174069042B
Show »

FASTA47552,202
Isoform 5 [UniParc].

Checksum: 6829135D1AEAF215
Show »

FASTA32035,756

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
Tissue: Placenta and Testis.
[2]"Human chromosome 11 DNA sequence and analysis including novel gene identification."
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. expand/collapse author list , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.
Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Pancreas.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK056094 mRNA. Translation: BAB71093.1.
AK300209 mRNA. Translation: BAG61979.1.
AK302256 mRNA. Translation: BAH13657.1.
AP001453 Genomic DNA. No translation available.
BC033920 mRNA. Translation: AAH33920.1.
BC035002 mRNA. Translation: AAH35002.1.
RefSeqNP_001164197.1. NM_001170726.1.
NP_001164351.1. NM_001170880.1.
NP_001164352.1. NM_001170881.1.
NP_001170829.1. NM_001177358.1.
NP_064540.3. NM_020155.3.
XP_005274157.1. XM_005274100.1.
XP_005274158.1. XM_005274101.1.
XP_005274159.1. XM_005274102.1.
XP_005274161.1. XM_005274104.1.
UniGeneHs.523763.

3D structure databases

ProteinModelPortalQ96N19.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000321698.

PTM databases

PhosphoSiteQ96N19.

Polymorphism databases

DMDM126302549.

Proteomic databases

PaxDbQ96N19.
PRIDEQ96N19.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000313074; ENSP00000321698; ENSG00000173264. [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264. [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264. [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264. [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264. [Q96N19-5]
GeneID56834.
KEGGhsa:56834.
UCSCuc001nze.2. human. [Q96N19-1]
uc001nzf.3. human. [Q96N19-3]
uc001nzi.3. human. [Q96N19-2]
uc010rni.2. human. [Q96N19-4]
uc010rnj.2. human. [Q96N19-5]

Organism-specific databases

CTD56834.
GeneCardsGC11P064051.
HGNCHGNC:24300. GPR137.
neXtProtNX_Q96N19.
PharmGKBPA143485482.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG74980.
HOGENOMHOG000286020.
HOVERGENHBG058911.
InParanoidQ96N19.
OMAREPGWCG.
PhylomeDBQ96N19.
TreeFamTF329003.

Gene expression databases

ArrayExpressQ96N19.
BgeeQ96N19.
CleanExHS_GPR137.
GenevestigatorQ96N19.

Family and domain databases

InterProIPR027209. GPR137.
[Graphical view]
PANTHERPTHR32550. PTHR32550. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi56834.
NextBio62240.
PROQ96N19.

Entry information

Entry nameG137A_HUMAN
AccessionPrimary (citable) accession number: Q96N19
Secondary accession number(s): B4DTG7 expand/collapse secondary AC list , B7Z7M1, Q4G0Y9, Q8N4K6
Entry history
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: February 20, 2007
Last modified: April 16, 2014
This is version 75 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 11

Human chromosome 11: entries, gene names and cross-references to MIM