Q96N19 (G137A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Integral membrane protein GPR137 Alternative name(s): Transmembrane 7 superfamily member 1-like 1 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 417 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the GPR137 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96N19-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96N19-2) The sequence of this isoform differs from the canonical sequence as follows: 344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT | ||||||
| Isoform 3 (identifier: Q96N19-3) The sequence of this isoform differs from the canonical sequence as follows: 212-261: Missing. 344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT | ||||||
| Isoform 4 (identifier: Q96N19-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q96N19-5) The sequence of this isoform differs from the canonical sequence as follows: 305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA 321-417: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 417 | 417 | Integral membrane protein GPR137 | PRO_0000269996 | |||||
Regions | |||||||||
| Topological domain | 1 – 31 | 31 | Extracellular Potential | ||||||
| Transmembrane | 32 – 52 | 21 | Helical; Potential | ||||||
| Topological domain | 53 – 60 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 61 – 81 | 21 | Helical; Potential | ||||||
| Topological domain | 82 – 89 | 8 | Extracellular Potential | ||||||
| Transmembrane | 90 – 110 | 21 | Helical; Potential | ||||||
| Topological domain | 111 – 140 | 30 | Cytoplasmic Potential | ||||||
| Transmembrane | 141 – 161 | 21 | Helical; Potential | ||||||
| Topological domain | 162 – 175 | 14 | Extracellular Potential | ||||||
| Transmembrane | 176 – 196 | 21 | Helical; Potential | ||||||
| Topological domain | 197 – 218 | 22 | Cytoplasmic Potential | ||||||
| Transmembrane | 219 – 241 | 23 | Helical; Potential | ||||||
| Topological domain | 242 – 274 | 33 | Extracellular Potential | ||||||
| Transmembrane | 275 – 295 | 21 | Helical; Potential | ||||||
| Topological domain | 296 – 417 | 122 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 4 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 257 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4. | VSP_043278 | |||||
| Alternative sequence | 212 – 261 | 50 | Missing in isoform 3. | VSP_022121 | |||||
| Alternative sequence | 305 – 320 | 16 | STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5. | VSP_043592 | |||||
| Alternative sequence | 321 – 417 | 97 | Missing in isoform 5. | VSP_043593 | |||||
| Alternative sequence | 344 – 417 | 74 | RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3. | VSP_022122 | |||||
Experimental info | |||||||||
| Sequence conflict | 254 | 1 | D → G in BAB71093. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5). Tissue: Placenta and Testis. |
| [2] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Pancreas. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK056094 mRNA. Translation: BAB71093.1. AK300209 mRNA. Translation: BAG61979.1. AK302256 mRNA. Translation: BAH13657.1. AP001453 Genomic DNA. No translation available. BC033920 mRNA. Translation: AAH33920.1. BC035002 mRNA. Translation: AAH35002.1. |
| IPI | IPI00140138. IPI00645236. IPI00815937. IPI00941884. IPI00956520. |
| RefSeq | NP_001164197.1. NM_001170726.1. NP_001164351.1. NM_001170880.1. NP_001164352.1. NM_001170881.1. NP_001170829.1. NM_001177358.1. NP_064540.3. NM_020155.3. |
| UniGene | Hs.523763. |
3D structure databases | |
| ProteinModelPortal | Q96N19. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000321698. |
PTM databases | |
| PhosphoSite | Q96N19. |
Polymorphism databases | |
| DMDM | 126302549. |
Proteomic databases | |
| PaxDb | Q96N19. |
| PRIDE | Q96N19. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313074; ENSP00000321698; ENSG00000173264. ENST00000377702; ENSP00000366931; ENSG00000173264. ENST00000411458; ENSP00000411827; ENSG00000173264. ENST00000438980; ENSP00000415698; ENSG00000173264. ENST00000539851; ENSP00000442792; ENSG00000173264. |
| GeneID | 56834. |
| KEGG | hsa:56834. |
| UCSC | uc001nze.2. human. uc001nzf.3. human. uc001nzi.3. human. |
Organism-specific databases | |
| CTD | 56834. |
| GeneCards | GC11P064051. |
| HGNC | HGNC:24300. GPR137. |
| neXtProt | NX_Q96N19. |
| PharmGKB | PA143485482. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG74980. |
| HOGENOM | HOG000286020. |
| HOVERGEN | HBG058911. |
| InParanoid | Q96N19. |
| OMA | REPGWCG. |
| OrthoDB | EOG44QT19. |
| PhylomeDB | Q96N19. |
Gene expression databases | |
| ArrayExpress | Q96N19. |
| Bgee | Q96N19. |
| CleanEx | HS_GPR137. |
| Genevestigator | Q96N19. |
Family and domain databases | |
| InterPro | IPR027209. GPR137. [Graphical view] |
| PANTHER | PTHR32550. PTHR32550. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 56834. |
| NextBio | 62240. |
Entry information
| Entry name | G137A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96N19 Secondary accession number(s): B4DTG7 Q8N4K6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
