Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96N19

- G137A_HUMAN

UniProt

Q96N19 - G137A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Integral membrane protein GPR137

Gene

GPR137

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Integral membrane protein GPR137
Alternative name(s):
Transmembrane 7 superfamily member 1-like 1 protein
Gene namesi
Name:GPR137
Synonyms:C11orf4, GPR137A, TM7SF1L1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:24300. GPR137.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
BLAST
Transmembranei32 – 5221HelicalSequence AnalysisAdd
BLAST
Topological domaini53 – 608CytoplasmicSequence Analysis
Transmembranei61 – 8121HelicalSequence AnalysisAdd
BLAST
Topological domaini82 – 898ExtracellularSequence Analysis
Transmembranei90 – 11021HelicalSequence AnalysisAdd
BLAST
Topological domaini111 – 14030CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei141 – 16121HelicalSequence AnalysisAdd
BLAST
Topological domaini162 – 17514ExtracellularSequence AnalysisAdd
BLAST
Transmembranei176 – 19621HelicalSequence AnalysisAdd
BLAST
Topological domaini197 – 21822CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei219 – 24123HelicalSequence AnalysisAdd
BLAST
Topological domaini242 – 27433ExtracellularSequence AnalysisAdd
BLAST
Transmembranei275 – 29521HelicalSequence AnalysisAdd
BLAST
Topological domaini296 – 417122CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA143485482.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 417417Integral membrane protein GPR137PRO_0000269996Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ96N19.
PRIDEiQ96N19.

PTM databases

PhosphoSiteiQ96N19.

Expressioni

Gene expression databases

BgeeiQ96N19.
CleanExiHS_GPR137.
ExpressionAtlasiQ96N19. baseline and differential.
GenevestigatoriQ96N19.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000321698.

Structurei

3D structure databases

ProteinModelPortaliQ96N19.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the GPR137 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG74980.
GeneTreeiENSGT00390000008320.
HOGENOMiHOG000286020.
HOVERGENiHBG058911.
InParanoidiQ96N19.
OMAiYPLLWPA.
PhylomeDBiQ96N19.
TreeFamiTF329003.

Family and domain databases

InterProiIPR029723. GPR137.
[Graphical view]
PANTHERiPTHR15146. PTHR15146. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96N19-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESNLSGLVP AAGLVPALPP AVTLGLTAAY TTLYALLFFS VYAQLWLVLL
60 70 80 90 100
YGHKRLSYQT VFLALCLLWA ALRTTLFSFY FRDTPRANRL GPLPFWLLYC
110 120 130 140 150
CPVCLQFFTL TLMNLYFAQV VFKAKVKRRP EMSRGLLAVR GAFVGASLLF
160 170 180 190 200
LLVNVLCAVL SHRRRAQPWA LLLVRVLVSD SLFVICALSL AACLCLVARR
210 220 230 240 250
APSTSIYLEA KGTSVCQAAA MGGAMVLLYA SRACYNLTAL ALAPQSRLDT
260 270 280 290 300
FDYDWYNVSD QADLVNDLGN KGYLVFGLIL FVWELLPTTL LVGFFRVHRP
310 320 330 340 350
PQDLSTSHIL NGQVFASRSY FFDRAGHCED EGCSWEHSRG ESTRCQDQAA
360 370 380 390 400
TTTVSTPPHR RDPPPSPTEY PGPSPPHPRP LCQVCLPLLA QDPGGRGYPL
410
LWPAPCCSCH SELVPSP
Length:417
Mass (Da):46,059
Last modified:February 20, 2007 - v2
Checksum:i4059610F4B822FCA
GO
Isoform 2 (identifier: Q96N19-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:396
Mass (Da):43,632
Checksum:iF95C30010101995F
GO
Isoform 3 (identifier: Q96N19-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     212-261: Missing.
     344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

Show »
Length:346
Mass (Da):38,256
Checksum:i597CE021C5309BD0
GO
Isoform 4 (identifier: Q96N19-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM

Note: No experimental confirmation available.

Show »
Length:475
Mass (Da):52,202
Checksum:iF2A08B174069042B
GO
Isoform 5 (identifier: Q96N19-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA
     321-417: Missing.

Note: No experimental confirmation available.

Show »
Length:320
Mass (Da):35,756
Checksum:i6829135D1AEAF215
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti254 – 2541D → G in BAB71093. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4. 1 PublicationVSP_043278
Alternative sequencei212 – 26150Missing in isoform 3. 1 PublicationVSP_022121Add
BLAST
Alternative sequencei305 – 32016STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5. 1 PublicationVSP_043592Add
BLAST
Alternative sequencei321 – 41797Missing in isoform 5. 1 PublicationVSP_043593Add
BLAST
Alternative sequencei344 – 41774RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3. 1 PublicationVSP_022122Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056094 mRNA. Translation: BAB71093.1.
AK300209 mRNA. Translation: BAG61979.1.
AK302256 mRNA. Translation: BAH13657.1.
AP001453 Genomic DNA. No translation available.
BC033920 mRNA. Translation: AAH33920.1.
BC035002 mRNA. Translation: AAH35002.1.
CCDSiCCDS53655.1. [Q96N19-4]
CCDS53656.1. [Q96N19-2]
CCDS53657.1. [Q96N19-5]
CCDS53658.1. [Q96N19-3]
CCDS8066.1. [Q96N19-1]
RefSeqiNP_001164197.1. NM_001170726.1. [Q96N19-4]
NP_001164351.1. NM_001170880.1. [Q96N19-2]
NP_001164352.1. NM_001170881.1. [Q96N19-3]
NP_001170829.1. NM_001177358.1. [Q96N19-5]
NP_064540.3. NM_020155.3. [Q96N19-1]
XP_005274157.1. XM_005274100.1. [Q96N19-1]
XP_005274158.1. XM_005274101.1. [Q96N19-1]
XP_005274159.1. XM_005274102.1. [Q96N19-1]
XP_005274161.1. XM_005274104.1. [Q96N19-1]
UniGeneiHs.523763.

Genome annotation databases

EnsembliENST00000313074; ENSP00000321698; ENSG00000173264. [Q96N19-1]
ENST00000377702; ENSP00000366931; ENSG00000173264. [Q96N19-3]
ENST00000411458; ENSP00000411827; ENSG00000173264. [Q96N19-4]
ENST00000438980; ENSP00000415698; ENSG00000173264. [Q96N19-2]
ENST00000539851; ENSP00000442792; ENSG00000173264. [Q96N19-5]
GeneIDi56834.
KEGGihsa:56834.
UCSCiuc001nze.2. human. [Q96N19-1]
uc001nzf.3. human. [Q96N19-3]
uc001nzi.3. human. [Q96N19-2]
uc010rni.2. human. [Q96N19-4]
uc010rnj.2. human. [Q96N19-5]

Polymorphism databases

DMDMi126302549.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056094 mRNA. Translation: BAB71093.1 .
AK300209 mRNA. Translation: BAG61979.1 .
AK302256 mRNA. Translation: BAH13657.1 .
AP001453 Genomic DNA. No translation available.
BC033920 mRNA. Translation: AAH33920.1 .
BC035002 mRNA. Translation: AAH35002.1 .
CCDSi CCDS53655.1. [Q96N19-4 ]
CCDS53656.1. [Q96N19-2 ]
CCDS53657.1. [Q96N19-5 ]
CCDS53658.1. [Q96N19-3 ]
CCDS8066.1. [Q96N19-1 ]
RefSeqi NP_001164197.1. NM_001170726.1. [Q96N19-4 ]
NP_001164351.1. NM_001170880.1. [Q96N19-2 ]
NP_001164352.1. NM_001170881.1. [Q96N19-3 ]
NP_001170829.1. NM_001177358.1. [Q96N19-5 ]
NP_064540.3. NM_020155.3. [Q96N19-1 ]
XP_005274157.1. XM_005274100.1. [Q96N19-1 ]
XP_005274158.1. XM_005274101.1. [Q96N19-1 ]
XP_005274159.1. XM_005274102.1. [Q96N19-1 ]
XP_005274161.1. XM_005274104.1. [Q96N19-1 ]
UniGenei Hs.523763.

3D structure databases

ProteinModelPortali Q96N19.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000321698.

PTM databases

PhosphoSitei Q96N19.

Polymorphism databases

DMDMi 126302549.

Proteomic databases

PaxDbi Q96N19.
PRIDEi Q96N19.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000313074 ; ENSP00000321698 ; ENSG00000173264 . [Q96N19-1 ]
ENST00000377702 ; ENSP00000366931 ; ENSG00000173264 . [Q96N19-3 ]
ENST00000411458 ; ENSP00000411827 ; ENSG00000173264 . [Q96N19-4 ]
ENST00000438980 ; ENSP00000415698 ; ENSG00000173264 . [Q96N19-2 ]
ENST00000539851 ; ENSP00000442792 ; ENSG00000173264 . [Q96N19-5 ]
GeneIDi 56834.
KEGGi hsa:56834.
UCSCi uc001nze.2. human. [Q96N19-1 ]
uc001nzf.3. human. [Q96N19-3 ]
uc001nzi.3. human. [Q96N19-2 ]
uc010rni.2. human. [Q96N19-4 ]
uc010rnj.2. human. [Q96N19-5 ]

Organism-specific databases

CTDi 56834.
GeneCardsi GC11P064051.
HGNCi HGNC:24300. GPR137.
neXtProti NX_Q96N19.
PharmGKBi PA143485482.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG74980.
GeneTreei ENSGT00390000008320.
HOGENOMi HOG000286020.
HOVERGENi HBG058911.
InParanoidi Q96N19.
OMAi YPLLWPA.
PhylomeDBi Q96N19.
TreeFami TF329003.

Miscellaneous databases

ChiTaRSi GPR137. human.
GenomeRNAii 56834.
NextBioi 62240.
PROi Q96N19.

Gene expression databases

Bgeei Q96N19.
CleanExi HS_GPR137.
ExpressionAtlasi Q96N19. baseline and differential.
Genevestigatori Q96N19.

Family and domain databases

InterProi IPR029723. GPR137.
[Graphical view ]
PANTHERi PTHR15146. PTHR15146. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
    Tissue: Placenta and Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Pancreas.

Entry informationi

Entry nameiG137A_HUMAN
AccessioniPrimary (citable) accession number: Q96N19
Secondary accession number(s): B4DTG7
, B7Z7M1, Q4G0Y9, Q8N4K6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: February 20, 2007
Last modified: November 26, 2014
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3