Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96N19

- G137A_HUMAN

UniProt

Q96N19 - G137A_HUMAN

Protein

Integral membrane protein GPR137

Gene

GPR137

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 79 (01 Oct 2014)
      Sequence version 2 (20 Feb 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Integral membrane protein GPR137
    Alternative name(s):
    Transmembrane 7 superfamily member 1-like 1 protein
    Gene namesi
    Name:GPR137
    Synonyms:C11orf4, GPR137A, TM7SF1L1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:24300. GPR137.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA143485482.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 417417Integral membrane protein GPR137PRO_0000269996Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi4 – 41N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi257 – 2571N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ96N19.
    PRIDEiQ96N19.

    PTM databases

    PhosphoSiteiQ96N19.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96N19.
    BgeeiQ96N19.
    CleanExiHS_GPR137.
    GenevestigatoriQ96N19.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000321698.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96N19.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3131ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini53 – 608CytoplasmicSequence Analysis
    Topological domaini82 – 898ExtracellularSequence Analysis
    Topological domaini111 – 14030CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini162 – 17514ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini197 – 21822CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini242 – 27433ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini296 – 417122CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei32 – 5221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei61 – 8121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei90 – 11021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei141 – 16121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei176 – 19621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei219 – 24123HelicalSequence AnalysisAdd
    BLAST
    Transmembranei275 – 29521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the GPR137 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG74980.
    HOGENOMiHOG000286020.
    HOVERGENiHBG058911.
    InParanoidiQ96N19.
    OMAiYPLLWPA.
    PhylomeDBiQ96N19.
    TreeFamiTF329003.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96N19-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESNLSGLVP AAGLVPALPP AVTLGLTAAY TTLYALLFFS VYAQLWLVLL    50
    YGHKRLSYQT VFLALCLLWA ALRTTLFSFY FRDTPRANRL GPLPFWLLYC 100
    CPVCLQFFTL TLMNLYFAQV VFKAKVKRRP EMSRGLLAVR GAFVGASLLF 150
    LLVNVLCAVL SHRRRAQPWA LLLVRVLVSD SLFVICALSL AACLCLVARR 200
    APSTSIYLEA KGTSVCQAAA MGGAMVLLYA SRACYNLTAL ALAPQSRLDT 250
    FDYDWYNVSD QADLVNDLGN KGYLVFGLIL FVWELLPTTL LVGFFRVHRP 300
    PQDLSTSHIL NGQVFASRSY FFDRAGHCED EGCSWEHSRG ESTRCQDQAA 350
    TTTVSTPPHR RDPPPSPTEY PGPSPPHPRP LCQVCLPLLA QDPGGRGYPL 400
    LWPAPCCSCH SELVPSP 417
    Length:417
    Mass (Da):46,059
    Last modified:February 20, 2007 - v2
    Checksum:i4059610F4B822FCA
    GO
    Isoform 2 (identifier: Q96N19-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

    Show »
    Length:396
    Mass (Da):43,632
    Checksum:iF95C30010101995F
    GO
    Isoform 3 (identifier: Q96N19-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         212-261: Missing.
         344-417: RCQDQAATTT...SCHSELVPSP → SMSGSLGSGS...HHSLYSTPQT

    Show »
    Length:346
    Mass (Da):38,256
    Checksum:i597CE021C5309BD0
    GO
    Isoform 4 (identifier: Q96N19-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLWAVRTRCYVVKAQLGPTVALEGRAPRAPGPSCLGNGNCQRPGPITSRNVTRASLPDM

    Note: No experimental confirmation available.

    Show »
    Length:475
    Mass (Da):52,202
    Checksum:iF2A08B174069042B
    GO
    Isoform 5 (identifier: Q96N19-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         305-320: STSHILNGQVFASRSY → YVGQSRLWELVWCHRA
         321-417: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:320
    Mass (Da):35,756
    Checksum:i6829135D1AEAF215
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti254 – 2541D → G in BAB71093. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLWAVRTRCYVVKAQLGPTV ALEGRAPRAPGPSCLGNGNC QRPGPITSRNVTRASLPDM in isoform 4. 1 PublicationVSP_043278
    Alternative sequencei212 – 26150Missing in isoform 3. 1 PublicationVSP_022121Add
    BLAST
    Alternative sequencei305 – 32016STSHI…ASRSY → YVGQSRLWELVWCHRA in isoform 5. 1 PublicationVSP_043592Add
    BLAST
    Alternative sequencei321 – 41797Missing in isoform 5. 1 PublicationVSP_043593Add
    BLAST
    Alternative sequencei344 – 41774RCQDQ…LVPSP → SMSGSLGSGSWYGAIGREPG WYGGSQTKTTPLLFSQVPGP GGHHHSLYSTPQT in isoform 2 and isoform 3. 1 PublicationVSP_022122Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056094 mRNA. Translation: BAB71093.1.
    AK300209 mRNA. Translation: BAG61979.1.
    AK302256 mRNA. Translation: BAH13657.1.
    AP001453 Genomic DNA. No translation available.
    BC033920 mRNA. Translation: AAH33920.1.
    BC035002 mRNA. Translation: AAH35002.1.
    CCDSiCCDS53655.1. [Q96N19-4]
    CCDS53656.1. [Q96N19-2]
    CCDS53657.1. [Q96N19-5]
    CCDS53658.1. [Q96N19-3]
    CCDS8066.1. [Q96N19-1]
    RefSeqiNP_001164197.1. NM_001170726.1. [Q96N19-4]
    NP_001164351.1. NM_001170880.1. [Q96N19-2]
    NP_001164352.1. NM_001170881.1. [Q96N19-3]
    NP_001170829.1. NM_001177358.1. [Q96N19-5]
    NP_064540.3. NM_020155.3. [Q96N19-1]
    XP_005274157.1. XM_005274100.1. [Q96N19-1]
    XP_005274158.1. XM_005274101.1. [Q96N19-1]
    XP_005274159.1. XM_005274102.1. [Q96N19-1]
    XP_005274161.1. XM_005274104.1. [Q96N19-1]
    UniGeneiHs.523763.

    Genome annotation databases

    EnsembliENST00000313074; ENSP00000321698; ENSG00000173264. [Q96N19-1]
    ENST00000377702; ENSP00000366931; ENSG00000173264. [Q96N19-3]
    ENST00000411458; ENSP00000411827; ENSG00000173264. [Q96N19-4]
    ENST00000438980; ENSP00000415698; ENSG00000173264. [Q96N19-2]
    ENST00000539851; ENSP00000442792; ENSG00000173264. [Q96N19-5]
    GeneIDi56834.
    KEGGihsa:56834.
    UCSCiuc001nze.2. human. [Q96N19-1]
    uc001nzf.3. human. [Q96N19-3]
    uc001nzi.3. human. [Q96N19-2]
    uc010rni.2. human. [Q96N19-4]
    uc010rnj.2. human. [Q96N19-5]

    Polymorphism databases

    DMDMi126302549.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056094 mRNA. Translation: BAB71093.1 .
    AK300209 mRNA. Translation: BAG61979.1 .
    AK302256 mRNA. Translation: BAH13657.1 .
    AP001453 Genomic DNA. No translation available.
    BC033920 mRNA. Translation: AAH33920.1 .
    BC035002 mRNA. Translation: AAH35002.1 .
    CCDSi CCDS53655.1. [Q96N19-4 ]
    CCDS53656.1. [Q96N19-2 ]
    CCDS53657.1. [Q96N19-5 ]
    CCDS53658.1. [Q96N19-3 ]
    CCDS8066.1. [Q96N19-1 ]
    RefSeqi NP_001164197.1. NM_001170726.1. [Q96N19-4 ]
    NP_001164351.1. NM_001170880.1. [Q96N19-2 ]
    NP_001164352.1. NM_001170881.1. [Q96N19-3 ]
    NP_001170829.1. NM_001177358.1. [Q96N19-5 ]
    NP_064540.3. NM_020155.3. [Q96N19-1 ]
    XP_005274157.1. XM_005274100.1. [Q96N19-1 ]
    XP_005274158.1. XM_005274101.1. [Q96N19-1 ]
    XP_005274159.1. XM_005274102.1. [Q96N19-1 ]
    XP_005274161.1. XM_005274104.1. [Q96N19-1 ]
    UniGenei Hs.523763.

    3D structure databases

    ProteinModelPortali Q96N19.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000321698.

    PTM databases

    PhosphoSitei Q96N19.

    Polymorphism databases

    DMDMi 126302549.

    Proteomic databases

    PaxDbi Q96N19.
    PRIDEi Q96N19.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000313074 ; ENSP00000321698 ; ENSG00000173264 . [Q96N19-1 ]
    ENST00000377702 ; ENSP00000366931 ; ENSG00000173264 . [Q96N19-3 ]
    ENST00000411458 ; ENSP00000411827 ; ENSG00000173264 . [Q96N19-4 ]
    ENST00000438980 ; ENSP00000415698 ; ENSG00000173264 . [Q96N19-2 ]
    ENST00000539851 ; ENSP00000442792 ; ENSG00000173264 . [Q96N19-5 ]
    GeneIDi 56834.
    KEGGi hsa:56834.
    UCSCi uc001nze.2. human. [Q96N19-1 ]
    uc001nzf.3. human. [Q96N19-3 ]
    uc001nzi.3. human. [Q96N19-2 ]
    uc010rni.2. human. [Q96N19-4 ]
    uc010rnj.2. human. [Q96N19-5 ]

    Organism-specific databases

    CTDi 56834.
    GeneCardsi GC11P064051.
    HGNCi HGNC:24300. GPR137.
    neXtProti NX_Q96N19.
    PharmGKBi PA143485482.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG74980.
    HOGENOMi HOG000286020.
    HOVERGENi HBG058911.
    InParanoidi Q96N19.
    OMAi YPLLWPA.
    PhylomeDBi Q96N19.
    TreeFami TF329003.

    Miscellaneous databases

    GenomeRNAii 56834.
    NextBioi 62240.
    PROi Q96N19.

    Gene expression databases

    ArrayExpressi Q96N19.
    Bgeei Q96N19.
    CleanExi HS_GPR137.
    Genevestigatori Q96N19.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4 AND 5).
      Tissue: Placenta and Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Pancreas.

    Entry informationi

    Entry nameiG137A_HUMAN
    AccessioniPrimary (citable) accession number: Q96N19
    Secondary accession number(s): B4DTG7
    , B7Z7M1, Q4G0Y9, Q8N4K6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 9, 2007
    Last sequence update: February 20, 2007
    Last modified: October 1, 2014
    This is version 79 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3