Q96MY7 (F161B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein FAM161B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 647 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Interacts with FAM161A. Ref.4 |
| Tissue specificity | Ubiquitously expressed. Ref.4 |
| Sequence similarities | Belongs to the FAM161 family. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MY7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96MY7-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRGENRPIGKRTLPPRAGWIGGCPGSQPDAKARKGWTLAPHSSRCHRCCHYRCHCRCCLCPAEM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 647 | 647 | Protein FAM161B | PRO_0000089890 | |||||
Regions | |||||||||
| Coiled coil | 262 – 292 | 31 | Potential | ||||||
| Coiled coil | 510 – 546 | 37 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRGENRPIGKRTLPPRAGWI GGCPGSQPDAKARKGWTLAP HSSRCHRCCHYRCHCRCCLC PAEM in isoform 2. | VSP_046328 | |||||
| Natural variant | 11 | 1 | G → A. Corresponds to variant rs11848954 [ dbSNP | Ensembl ]. | VAR_027963 | |||||
| Natural variant | 487 | 1 | K → R. Ref.1 Corresponds to variant rs28927675 [ dbSNP | Ensembl ]. | VAR_069168 | |||||
| Natural variant | 622 | 1 | L → P. Corresponds to variant rs17094077 [ dbSNP | Ensembl ]. | VAR_027964 | |||||
Experimental info | |||||||||
| Sequence conflict | 57 | 1 | I → M in BAB71131. Ref.1 | ||||||
| Sequence conflict | 96 | 1 | N → S in BAH13868. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ARG-487. Tissue: Neuron and Testis. |
| [2] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [4] | "The retinitis pigmentosa 28 protein FAM161A is a novel ciliary protein involved in intermolecular protein interaction and microtubule association." Zach F., Grassmann F., Langmann T., Sorusch N., Wolfrum U., Stohr H. Hum. Mol. Genet. 21:4573-4586(2012) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, INTERACTION WITH FAM161A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK056259 mRNA. Translation: BAB71131.1. AK302982 mRNA. Translation: BAH13868.1. AC005480 Genomic DNA. No translation available. BC053909 mRNA. Translation: AAH53909.1. |
| IPI | IPI00043526. IPI01009729. |
| RefSeq | NP_689658.2. NM_152445.2. |
| UniGene | Hs.550547. Hs.660789. |
3D structure databases | |
| ProteinModelPortal | Q96MY7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-1195327. |
PTM databases | |
| PhosphoSite | Q96MY7. |
Polymorphism databases | |
| DMDM | 116241303. |
Proteomic databases | |
| PaxDb | Q96MY7. |
| PRIDE | Q96MY7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000286544; ENSP00000286544; ENSG00000156050. ENST00000534936; ENSP00000445326; ENSG00000156050. |
| GeneID | 145483. |
| KEGG | hsa:145483. |
Organism-specific databases | |
| CTD | 145483. |
| GeneCards | GC14M074400. |
| HGNC | HGNC:19854. FAM161B. |
| HPA | HPA019125. |
| neXtProt | NX_Q96MY7. |
| PharmGKB | PA162386893. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG80167. |
| HOVERGEN | HBG051009. |
| InParanoid | Q96MY7. |
| OrthoDB | EOG4W3SN9. |
| PhylomeDB | Q96MY7. |
Gene expression databases | |
| Bgee | Q96MY7. |
| CleanEx | HS_FAM161B. |
| Genevestigator | Q96MY7. |
| GermOnline | ENSG00000156050. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019579. UPF0564. [Graphical view] |
| Pfam | PF10595. UPF0564. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 145483. |
| NextBio | 35534861. |
Entry information
| Entry name | F161B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MY7 Secondary accession number(s): B7Z882, J3KNA2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
