Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM161B

Gene

FAM161B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM161B
Gene namesi
Name:FAM161B
Synonyms:C14orf44
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

EuPathDBiHostDB:ENSG00000156050.8
HGNCiHGNC:19854 FAM161B
neXtProtiNX_Q96MY7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000156050
PharmGKBiPA162386893

Polymorphism and mutation databases

BioMutaiFAM161B
DMDMi116241303

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000898901 – 647Protein FAM161BAdd BLAST647

Proteomic databases

PaxDbiQ96MY7
PeptideAtlasiQ96MY7
PRIDEiQ96MY7

PTM databases

iPTMnetiQ96MY7
PhosphoSitePlusiQ96MY7

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000156050
CleanExiHS_FAM161B
ExpressionAtlasiQ96MY7 baseline and differential
GenevisibleiQ96MY7 HS

Organism-specific databases

HPAiHPA019125

Interactioni

Subunit structurei

Interacts with FAM161A.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi126916, 3 interactors
IntActiQ96MY7, 59 interactors
MINTiQ96MY7
STRINGi9606.ENSP00000286544

Structurei

3D structure databases

ProteinModelPortaliQ96MY7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili262 – 292Sequence analysisAdd BLAST31
Coiled coili510 – 546Sequence analysisAdd BLAST37

Sequence similaritiesi

Belongs to the FAM161 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFP6 Eukaryota
ENOG4111FGW LUCA
GeneTreeiENSGT00530000063901
HOGENOMiHOG000112440
HOVERGENiHBG051009
InParanoidiQ96MY7
OMAiCHRQFRA
OrthoDBiEOG091G054R
PhylomeDBiQ96MY7
TreeFamiTF321199

Family and domain databases

InterProiView protein in InterPro
IPR019579 UPF0564
PfamiView protein in Pfam
PF10595 UPF0564, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MY7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTVGRPEGAP GGAEGSRQIF PPESFADTEA GEELSGDGLV LPRASKLDEF
60 70 80 90 100
LSPEEEIDST SDSTGSIYQN LQELKQKGRW CLLESLFQSD PESDENLSED
110 120 130 140 150
EEDLESFFQD KDRGMVQVQC PQALRCGSTR RCSSLNNLPS NIPRPQTQPP
160 170 180 190 200
SGSRPPSQHR SVSSWASSIT VPRPFRMTLR EARKKAEWLG SPASFEQERQ
210 220 230 240 250
RAQRQGEEEA ECHRQFRAQP VPAHVYLPLY QEIMERSEAR RQAGIQKRKE
260 270 280 290 300
LLLSSLKPFS FLEKEEQLKE AARQRDLAAT AEAKISKQKA TRRIPKSILE
310 320 330 340 350
PALGDKLQEA ELFRKIRIQM RALDMLQMAS SPIASSSNRA NPQPRTATRT
360 370 380 390 400
QQEKLGFLHT NFRFQPRVNP VVPDYEGLYK AFQRRAAKRR ETQEATRNKP
410 420 430 440 450
FLLRTANLRH PQRPCDAATT GRRQDSPQPP ATPLPRSRSL SGLASLSANT
460 470 480 490 500
LPVHITDATR KRESAVRSAL EKKNKADESI QWLEIHKKKS QAMSKSVTLR
510 520 530 540 550
AKAMDPHKSL EEVFKAKLKE NRNNDRKRAK EYKKELEEMK QRIQTRPYLF
560 570 580 590 600
EQVAKDLAKK EAEQWYLDTL KQAGLEEDFV RNKGQGTRAV QEKETKIKDF
610 620 630 640
PRFQETTKLS IRDPEQGLEG SLEQPASPRK VLEELSHQSP ENLVSLA
Length:647
Mass (Da):73,647
Last modified:October 17, 2006 - v2
Checksum:i11EB0F73E24F2948
GO
Isoform 2 (identifier: Q96MY7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGENRPIGKRTLPPRAGWIGGCPGSQPDAKARKGWTLAPHSSRCHRCCHYRCHCRCCLCPAEM

Note: No experimental confirmation available.
Show »
Length:710
Mass (Da):80,660
Checksum:i4987BCB424E2E3C8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti57I → M in BAB71131 (PubMed:14702039).Curated1
Sequence conflicti96N → S in BAH13868 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02796311G → A. Corresponds to variant dbSNP:rs11848954Ensembl.1
Natural variantiVAR_069168487K → R1 PublicationCorresponds to variant dbSNP:rs28927675Ensembl.1
Natural variantiVAR_027964622L → P. Corresponds to variant dbSNP:rs17094077Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0463281M → MRGENRPIGKRTLPPRAGWI GGCPGSQPDAKARKGWTLAP HSSRCHRCCHYRCHCRCCLC PAEM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056259 mRNA Translation: BAB71131.1
AK302982 mRNA Translation: BAH13868.1
AC005480 Genomic DNA No translation available.
BC053909 mRNA Translation: AAH53909.1
CCDSiCCDS9822.2 [Q96MY7-2]
RefSeqiNP_689658.2, NM_152445.2 [Q96MY7-2]
UniGeneiHs.550547
Hs.660789

Genome annotation databases

EnsembliENST00000286544; ENSP00000286544; ENSG00000156050 [Q96MY7-2]
GeneIDi145483
KEGGihsa:145483
UCSCiuc001xpd.4 human [Q96MY7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiF161B_HUMAN
AccessioniPrimary (citable) accession number: Q96MY7
Secondary accession number(s): B7Z882, J3KNA2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: October 17, 2006
Last modified: February 28, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health