Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM161B

Gene

FAM161B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000156050-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM161B
Gene namesi
Name:FAM161B
Synonyms:C14orf44
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 14

Organism-specific databases

HGNCiHGNC:19854. FAM161B.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000156050.
PharmGKBiPA162386893.

Polymorphism and mutation databases

BioMutaiFAM161B.
DMDMi116241303.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000898901 – 647Protein FAM161BAdd BLAST647

Proteomic databases

PaxDbiQ96MY7.
PeptideAtlasiQ96MY7.
PRIDEiQ96MY7.

PTM databases

iPTMnetiQ96MY7.
PhosphoSitePlusiQ96MY7.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000156050.
CleanExiHS_FAM161B.
ExpressionAtlasiQ96MY7. baseline and differential.
GenevisibleiQ96MY7. HS.

Organism-specific databases

HPAiHPA019125.

Interactioni

Subunit structurei

Interacts with FAM161A.1 Publication

Protein-protein interaction databases

BioGridi126916. 3 interactors.
IntActiQ96MY7. 42 interactors.
MINTiMINT-1195327.
STRINGi9606.ENSP00000286544.

Structurei

3D structure databases

ProteinModelPortaliQ96MY7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili262 – 292Sequence analysisAdd BLAST31
Coiled coili510 – 546Sequence analysisAdd BLAST37

Sequence similaritiesi

Belongs to the FAM161 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IFP6. Eukaryota.
ENOG4111FGW. LUCA.
GeneTreeiENSGT00530000063901.
HOGENOMiHOG000112440.
HOVERGENiHBG051009.
InParanoidiQ96MY7.
OMAiCHRQFRA.
OrthoDBiEOG091G054R.
PhylomeDBiQ96MY7.
TreeFamiTF321199.

Family and domain databases

InterProiIPR019579. UPF0564.
[Graphical view]
PfamiPF10595. UPF0564. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MY7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTVGRPEGAP GGAEGSRQIF PPESFADTEA GEELSGDGLV LPRASKLDEF
60 70 80 90 100
LSPEEEIDST SDSTGSIYQN LQELKQKGRW CLLESLFQSD PESDENLSED
110 120 130 140 150
EEDLESFFQD KDRGMVQVQC PQALRCGSTR RCSSLNNLPS NIPRPQTQPP
160 170 180 190 200
SGSRPPSQHR SVSSWASSIT VPRPFRMTLR EARKKAEWLG SPASFEQERQ
210 220 230 240 250
RAQRQGEEEA ECHRQFRAQP VPAHVYLPLY QEIMERSEAR RQAGIQKRKE
260 270 280 290 300
LLLSSLKPFS FLEKEEQLKE AARQRDLAAT AEAKISKQKA TRRIPKSILE
310 320 330 340 350
PALGDKLQEA ELFRKIRIQM RALDMLQMAS SPIASSSNRA NPQPRTATRT
360 370 380 390 400
QQEKLGFLHT NFRFQPRVNP VVPDYEGLYK AFQRRAAKRR ETQEATRNKP
410 420 430 440 450
FLLRTANLRH PQRPCDAATT GRRQDSPQPP ATPLPRSRSL SGLASLSANT
460 470 480 490 500
LPVHITDATR KRESAVRSAL EKKNKADESI QWLEIHKKKS QAMSKSVTLR
510 520 530 540 550
AKAMDPHKSL EEVFKAKLKE NRNNDRKRAK EYKKELEEMK QRIQTRPYLF
560 570 580 590 600
EQVAKDLAKK EAEQWYLDTL KQAGLEEDFV RNKGQGTRAV QEKETKIKDF
610 620 630 640
PRFQETTKLS IRDPEQGLEG SLEQPASPRK VLEELSHQSP ENLVSLA
Length:647
Mass (Da):73,647
Last modified:October 17, 2006 - v2
Checksum:i11EB0F73E24F2948
GO
Isoform 2 (identifier: Q96MY7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGENRPIGKRTLPPRAGWIGGCPGSQPDAKARKGWTLAPHSSRCHRCCHYRCHCRCCLCPAEM

Note: No experimental confirmation available.
Show »
Length:710
Mass (Da):80,660
Checksum:i4987BCB424E2E3C8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti57I → M in BAB71131 (PubMed:14702039).Curated1
Sequence conflicti96N → S in BAH13868 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02796311G → A.Corresponds to variant rs11848954dbSNPEnsembl.1
Natural variantiVAR_069168487K → R.1 PublicationCorresponds to variant rs28927675dbSNPEnsembl.1
Natural variantiVAR_027964622L → P.Corresponds to variant rs17094077dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0463281M → MRGENRPIGKRTLPPRAGWI GGCPGSQPDAKARKGWTLAP HSSRCHRCCHYRCHCRCCLC PAEM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056259 mRNA. Translation: BAB71131.1.
AK302982 mRNA. Translation: BAH13868.1.
AC005480 Genomic DNA. No translation available.
BC053909 mRNA. Translation: AAH53909.1.
CCDSiCCDS9822.2. [Q96MY7-2]
RefSeqiNP_689658.2. NM_152445.2. [Q96MY7-2]
UniGeneiHs.550547.
Hs.660789.

Genome annotation databases

EnsembliENST00000286544; ENSP00000286544; ENSG00000156050. [Q96MY7-2]
GeneIDi145483.
KEGGihsa:145483.
UCSCiuc001xpd.4. human. [Q96MY7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056259 mRNA. Translation: BAB71131.1.
AK302982 mRNA. Translation: BAH13868.1.
AC005480 Genomic DNA. No translation available.
BC053909 mRNA. Translation: AAH53909.1.
CCDSiCCDS9822.2. [Q96MY7-2]
RefSeqiNP_689658.2. NM_152445.2. [Q96MY7-2]
UniGeneiHs.550547.
Hs.660789.

3D structure databases

ProteinModelPortaliQ96MY7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126916. 3 interactors.
IntActiQ96MY7. 42 interactors.
MINTiMINT-1195327.
STRINGi9606.ENSP00000286544.

PTM databases

iPTMnetiQ96MY7.
PhosphoSitePlusiQ96MY7.

Polymorphism and mutation databases

BioMutaiFAM161B.
DMDMi116241303.

Proteomic databases

PaxDbiQ96MY7.
PeptideAtlasiQ96MY7.
PRIDEiQ96MY7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000286544; ENSP00000286544; ENSG00000156050. [Q96MY7-2]
GeneIDi145483.
KEGGihsa:145483.
UCSCiuc001xpd.4. human. [Q96MY7-1]

Organism-specific databases

CTDi145483.
GeneCardsiFAM161B.
HGNCiHGNC:19854. FAM161B.
HPAiHPA019125.
neXtProtiNX_Q96MY7.
OpenTargetsiENSG00000156050.
PharmGKBiPA162386893.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFP6. Eukaryota.
ENOG4111FGW. LUCA.
GeneTreeiENSGT00530000063901.
HOGENOMiHOG000112440.
HOVERGENiHBG051009.
InParanoidiQ96MY7.
OMAiCHRQFRA.
OrthoDBiEOG091G054R.
PhylomeDBiQ96MY7.
TreeFamiTF321199.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000156050-MONOMER.

Miscellaneous databases

GenomeRNAii145483.
PROiQ96MY7.

Gene expression databases

BgeeiENSG00000156050.
CleanExiHS_FAM161B.
ExpressionAtlasiQ96MY7. baseline and differential.
GenevisibleiQ96MY7. HS.

Family and domain databases

InterProiIPR019579. UPF0564.
[Graphical view]
PfamiPF10595. UPF0564. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiF161B_HUMAN
AccessioniPrimary (citable) accession number: Q96MY7
Secondary accession number(s): B7Z882, J3KNA2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2003
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.