Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96MT8

- CEP63_HUMAN

UniProt

Q96MT8 - CEP63_HUMAN

Protein

Centrosomal protein of 63 kDa

Gene

CEP63

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for normal spindle assembly. Plays a key role in mother-centriole-dependent centriole duplication, through centrosomal recruitment of CEP152. Also recruits CDK1 to centrosomes. Plays a role in DNA damage response. Following DNA damage, such as double-strand breaks (DSBs), is removed from centrosomes; this leads to the inactivation of spindle assembly and delay in mitotic progression.2 Publications

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. centriole replication Source: UniProtKB
    2. DNA damage checkpoint Source: UniProtKB
    3. G2/M transition of mitotic cell cycle Source: Reactome
    4. mitotic cell cycle Source: Reactome
    5. mitotic nuclear division Source: UniProtKB-KW
    6. signal transduction in response to DNA damage Source: UniProtKB
    7. spindle assembly Source: UniProtKB

    Keywords - Biological processi

    Cell cycle, Cell division, DNA damage, Mitosis

    Enzyme and pathway databases

    ReactomeiREACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centrosomal protein of 63 kDa
    Short name:
    Cep63
    Gene namesi
    Name:CEP63
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:25815. CEP63.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole
    Note: Colocalizes with CEP152 in a discrete ring around the proximal end of the parental centriole. At this site, a cohesive structure is predicted to engage parental centrioles and procentrioles.

    GO - Cellular componenti

    1. centriole Source: UniProtKB
    2. centrosome Source: UniProtKB
    3. cytosol Source: Reactome
    4. spindle pole Source: UniProtKB

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Involvement in diseasei

    Seckel syndrome 6 (SCKL6) [MIM:614728]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.

    Keywords - Diseasei

    Dwarfism, Mental retardation

    Organism-specific databases

    MIMi614728. phenotype.
    Orphaneti2512. Autosomal recessive primary microcephaly.
    PharmGKBiPA142672124.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 703703Centrosomal protein of 63 kDaPRO_0000089493Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ96MT8.
    PaxDbiQ96MT8.
    PRIDEiQ96MT8.

    PTM databases

    PhosphoSiteiQ96MT8.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96MT8.
    BgeeiQ96MT8.
    CleanExiHS_CEP63.
    GenevestigatoriQ96MT8.

    Organism-specific databases

    HPAiHPA058154.
    HPA058313.

    Interactioni

    Subunit structurei

    Interacts with CEP152 and CDK1; these interactions recruit both ligands to centrosomes. May also interact with CDK2.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    DISC1Q9NRI57EBI-741977,EBI-529989

    Protein-protein interaction databases

    BioGridi123200. 24 interactions.
    DIPiDIP-36374N.
    IntActiQ96MT8. 25 interactions.
    MINTiMINT-1443653.
    STRINGi9606.ENSP00000336524.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96MT8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili22 – 199178Sequence AnalysisAdd
    BLAST
    Coiled coili242 – 30665Sequence AnalysisAdd
    BLAST
    Coiled coili353 – 533181Sequence AnalysisAdd
    BLAST
    Coiled coili676 – 70328Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the CEP63 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG116818.
    InParanoidiQ96MT8.
    KOiK16763.
    OMAiKNTEFKP.
    OrthoDBiEOG71G9T8.
    PhylomeDBiQ96MT8.
    TreeFamiTF330595.

    Family and domain databases

    InterProiIPR029608. Cep63.
    [Graphical view]
    PANTHERiPTHR18875:SF6. PTHR18875:SF6. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96MT8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEALLEGIQN RGHGGGFLTS CEAELQELMK QIDIMVAHKK SEWEGRTHAL    50
    ETCLKIREQE LKSLRSQLDV THKEVGMLHQ QVEEHEKIKQ EMTMEYKQEL 100
    KKLHEELCIL KRSYEKLQKK QMREFRGNTK NHREDRSEIE RLTAKIEEFR 150
    QKSLDWEKQR LIYQQQVSSL EAQRKALAEQ SEIIQAQLVN RKQKLESVEL 200
    SSQSEIQHLS SKLERANDTI CANELEIERL TMRVNDLVGT SMTVLQEQQQ 250
    KEEKLRESEK LLEALQEEKR ELKAALQSQE NLIHEARIQK EKLQEKVKAT 300
    NTQHAVEAIR PREESLAEKK YTSQGQGDLD SVLSQLNFTH TSEDLLQAEV 350
    TCLEGSLESV SATCKQLSQE LMEKYEELKR MEAHNNEYKA EIKKLKEQIL 400
    QGEQSYSSAL EGMKMEISHL TQELHQRDIT IASTKGSSSD MEKRLRAEMQ 450
    KAEDKAVEHK EILDQLESLK LENRHLSEMV MKLELGLHEA KEISLADLQE 500
    NYIEALNKLV SENQQLQKDL MNTKSQLEIS TQMCKKQNDR IFKPTHSRTT 550
    EFKNTEFKPT HGQHRHDGIK TEHYKTDLHS PRGQASDSIN PMSRVLSPLS 600
    PQISPCSSTR SLTSYSLCKT HSLPSALDTN EANFSDTMSE SMNDQEEFIS 650
    SCSLPVSPLG SIATRFLEEE ELRSHHILER LDAHIEELKR ESEKTVRQFT 700
    ALK 703
    Length:703
    Mass (Da):81,344
    Last modified:December 1, 2001 - v1
    Checksum:iD5406B75BB19B5D0
    GO
    Isoform 2 (identifier: Q96MT8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         490-651: Missing.

    Show »
    Length:541
    Mass (Da):63,015
    Checksum:iF4D363D9A3DBCF81
    GO
    Isoform 3 (identifier: Q96MT8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         310-355: Missing.
         490-651: Missing.

    Show »
    Length:495
    Mass (Da):57,908
    Checksum:iB03D8ECF77C790C4
    GO
    Isoform 4 (identifier: Q96MT8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         310-355: Missing.
         490-521: AKEISLADLQENYIEALNKLVSENQQLQKDLM → RWGFTMLSSLVLNFGIQAIRQPQRPKVLELQV
         522-703: Missing.

    Show »
    Length:475
    Mass (Da):55,591
    Checksum:i74DF3B1F93503B2D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti365 – 3651K → R in BAB14662. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti651 – 6511S → L.
    Corresponds to variant rs1127826 [ dbSNP | Ensembl ].
    VAR_020604

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei310 – 35546Missing in isoform 3 and isoform 4. 2 PublicationsVSP_012251Add
    BLAST
    Alternative sequencei490 – 651162Missing in isoform 2 and isoform 3. 2 PublicationsVSP_012252Add
    BLAST
    Alternative sequencei490 – 52132AKEIS…QKDLM → RWGFTMLSSLVLNFGIQAIR QPQRPKVLELQV in isoform 4. 1 PublicationVSP_012253Add
    BLAST
    Alternative sequencei522 – 703182Missing in isoform 4. 1 PublicationVSP_012254Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023448 mRNA. Translation: BAB14578.1.
    AK023738 mRNA. Translation: BAB14662.1.
    AK056465 mRNA. Translation: BAB71192.1.
    CH471052 Genomic DNA. Translation: EAW79136.1.
    CH471052 Genomic DNA. Translation: EAW79137.1.
    CH471052 Genomic DNA. Translation: EAW79138.1.
    CH471052 Genomic DNA. Translation: EAW79139.1.
    CH471052 Genomic DNA. Translation: EAW79140.1.
    CH471052 Genomic DNA. Translation: EAW79141.1.
    BC014050 mRNA. Translation: AAH14050.1.
    BC068997 mRNA. Translation: AAH68997.1.
    BK005503 mRNA. Translation: DAA05503.1.
    CCDSiCCDS3086.1. [Q96MT8-1]
    CCDS43152.1. [Q96MT8-4]
    CCDS43153.1. [Q96MT8-2]
    CCDS43154.1. [Q96MT8-3]
    RefSeqiNP_001035842.1. NM_001042383.1. [Q96MT8-3]
    NP_001035843.1. NM_001042384.1. [Q96MT8-4]
    NP_001035859.1. NM_001042400.1. [Q96MT8-2]
    NP_079456.2. NM_025180.3. [Q96MT8-1]
    XP_005247854.1. XM_005247797.1. [Q96MT8-1]
    XP_006713823.1. XM_006713760.1. [Q96MT8-1]
    UniGeneiHs.443301.

    Genome annotation databases

    EnsembliENST00000332047; ENSP00000328382; ENSG00000182923. [Q96MT8-3]
    ENST00000337090; ENSP00000336524; ENSG00000182923. [Q96MT8-1]
    ENST00000354446; ENSP00000346432; ENSG00000182923. [Q96MT8-4]
    ENST00000383229; ENSP00000372716; ENSG00000182923. [Q96MT8-2]
    ENST00000513612; ENSP00000426129; ENSG00000182923. [Q96MT8-1]
    ENST00000606977; ENSP00000475903; ENSG00000182923. [Q96MT8-1]
    GeneIDi80254.
    KEGGihsa:80254.
    UCSCiuc003eql.1. human. [Q96MT8-3]
    uc003eqm.3. human. [Q96MT8-4]
    uc003eqn.1. human. [Q96MT8-2]
    uc003eqo.1. human. [Q96MT8-1]

    Polymorphism databases

    DMDMi56748851.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023448 mRNA. Translation: BAB14578.1 .
    AK023738 mRNA. Translation: BAB14662.1 .
    AK056465 mRNA. Translation: BAB71192.1 .
    CH471052 Genomic DNA. Translation: EAW79136.1 .
    CH471052 Genomic DNA. Translation: EAW79137.1 .
    CH471052 Genomic DNA. Translation: EAW79138.1 .
    CH471052 Genomic DNA. Translation: EAW79139.1 .
    CH471052 Genomic DNA. Translation: EAW79140.1 .
    CH471052 Genomic DNA. Translation: EAW79141.1 .
    BC014050 mRNA. Translation: AAH14050.1 .
    BC068997 mRNA. Translation: AAH68997.1 .
    BK005503 mRNA. Translation: DAA05503.1 .
    CCDSi CCDS3086.1. [Q96MT8-1 ]
    CCDS43152.1. [Q96MT8-4 ]
    CCDS43153.1. [Q96MT8-2 ]
    CCDS43154.1. [Q96MT8-3 ]
    RefSeqi NP_001035842.1. NM_001042383.1. [Q96MT8-3 ]
    NP_001035843.1. NM_001042384.1. [Q96MT8-4 ]
    NP_001035859.1. NM_001042400.1. [Q96MT8-2 ]
    NP_079456.2. NM_025180.3. [Q96MT8-1 ]
    XP_005247854.1. XM_005247797.1. [Q96MT8-1 ]
    XP_006713823.1. XM_006713760.1. [Q96MT8-1 ]
    UniGenei Hs.443301.

    3D structure databases

    ProteinModelPortali Q96MT8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123200. 24 interactions.
    DIPi DIP-36374N.
    IntActi Q96MT8. 25 interactions.
    MINTi MINT-1443653.
    STRINGi 9606.ENSP00000336524.

    PTM databases

    PhosphoSitei Q96MT8.

    Polymorphism databases

    DMDMi 56748851.

    Proteomic databases

    MaxQBi Q96MT8.
    PaxDbi Q96MT8.
    PRIDEi Q96MT8.

    Protocols and materials databases

    DNASUi 80254.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000332047 ; ENSP00000328382 ; ENSG00000182923 . [Q96MT8-3 ]
    ENST00000337090 ; ENSP00000336524 ; ENSG00000182923 . [Q96MT8-1 ]
    ENST00000354446 ; ENSP00000346432 ; ENSG00000182923 . [Q96MT8-4 ]
    ENST00000383229 ; ENSP00000372716 ; ENSG00000182923 . [Q96MT8-2 ]
    ENST00000513612 ; ENSP00000426129 ; ENSG00000182923 . [Q96MT8-1 ]
    ENST00000606977 ; ENSP00000475903 ; ENSG00000182923 . [Q96MT8-1 ]
    GeneIDi 80254.
    KEGGi hsa:80254.
    UCSCi uc003eql.1. human. [Q96MT8-3 ]
    uc003eqm.3. human. [Q96MT8-4 ]
    uc003eqn.1. human. [Q96MT8-2 ]
    uc003eqo.1. human. [Q96MT8-1 ]

    Organism-specific databases

    CTDi 80254.
    GeneCardsi GC03P134204.
    GeneReviewsi CEP63.
    HGNCi HGNC:25815. CEP63.
    HPAi HPA058154.
    HPA058313.
    MIMi 614724. gene.
    614728. phenotype.
    neXtProti NX_Q96MT8.
    Orphaneti 2512. Autosomal recessive primary microcephaly.
    PharmGKBi PA142672124.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG116818.
    InParanoidi Q96MT8.
    KOi K16763.
    OMAi KNTEFKP.
    OrthoDBi EOG71G9T8.
    PhylomeDBi Q96MT8.
    TreeFami TF330595.

    Enzyme and pathway databases

    Reactomei REACT_15296. Recruitment of mitotic centrosome proteins and complexes.
    REACT_15364. Loss of Nlp from mitotic centrosomes.
    REACT_15451. Loss of proteins required for interphase microtubule organization from the centrosome.
    REACT_160315. Regulation of PLK1 Activity at G2/M Transition.

    Miscellaneous databases

    ChiTaRSi CEP63. human.
    GeneWikii CEP63.
    GenomeRNAii 80254.
    NextBioi 70695.
    PROi Q96MT8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96MT8.
    Bgeei Q96MT8.
    CleanExi HS_CEP63.
    Genevestigatori Q96MT8.

    Family and domain databases

    InterProi IPR029608. Cep63.
    [Graphical view ]
    PANTHERi PTHR18875:SF6. PTHR18875:SF6. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4).
      Tissue: Placenta and Teratocarcinoma.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Pancreas.
    4. "Proteomic characterization of the human centrosome by protein correlation profiling."
      Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M.
      Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 3), SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Lymphoblast.
    5. "Cep63 recruits Cdk1 to the centrosome: implications for regulation of mitotic entry, centrosome amplification, and genome maintenance."
      Loffler H., Fechter A., Matuszewska M., Saffrich R., Mistrik M., Marhold J., Hornung C., Westermann F., Bartek J., Kramer A.
      Cancer Res. 71:2129-2139(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CDK1 AND CDK2, SUBCELLULAR LOCATION.
    6. "A primary microcephaly protein complex forms a ring around parental centrioles."
      Sir J.H., Barr A.R., Nicholas A.K., Carvalho O.P., Khurshid M., Sossick A., Reichelt S., D'Santos C., Woods C.G., Gergely F.
      Nat. Genet. 43:1147-1153(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: INVOLVEMENT IN SCKL6, FUNCTION, INTERACTION WITH CEP152, SUBCELLULAR LOCATION.
    7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCEP63_HUMAN
    AccessioniPrimary (citable) accession number: Q96MT8
    Secondary accession number(s): D3DND8
    , D3DND9, D3DNE0, Q96CR0, Q9H8F5, Q9H8N0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 21, 2004
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 95 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    CEP63 and CCDC67/DEUP1 paralogs are both involved in centriole amplification: while CEP63 mediates mother-centriole-dependent centriole duplication, CCDC67/DEUP1 mediates de novo centriole amplification in multiciliated cells.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3