Q96MT8 (CEP63_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centrosomal protein of 63 kDa Short name=Cep63 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 703 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for normal spindle assembly. Maintains centrosome numbers through centrosomal recruitment of CEP152. Also recruits CDK1 to centrosomes. Plays a role in DNA damage response. Following DNA damage, such as double-strand breaks (DSBs), is removed from centrosomes; this leads to the inactivation of spindle assembly and delay in mitotic progression By similarity. Ref.5 Ref.6 |
| Subunit structure | Interacts with CEP152 and CDK1; these interactions recruit both ligands to centrosomes. May also interact with CDK2. Ref.5 Ref.6 |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome. Note: Colocalizes with CEP152 in a discrete ring around the proximal end of the parental centriole. At this site, a cohesive structure is predicted to engage parental centrioles and procentrioles. Ref.4 Ref.5 Ref.6 |
| Involvement in disease | Seckel syndrome 6 (SCKL6) [MIM:614728]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation. |
| Sequence similarities | Belongs to the CEP63 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| DISC1 | Q9NRI5 | 7 | EBI-741977,EBI-529989 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MT8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96MT8-2) The sequence of this isoform differs from the canonical sequence as follows: 490-651: Missing. | ||||||
| Isoform 3 (identifier: Q96MT8-3) The sequence of this isoform differs from the canonical sequence as follows: 310-355: Missing. 490-651: Missing. | ||||||
| Isoform 4 (identifier: Q96MT8-4) The sequence of this isoform differs from the canonical sequence as follows: 310-355: Missing. 490-521: AKEISLADLQENYIEALNKLVSENQQLQKDLM → RWGFTMLSSLVLNFGIQAIRQPQRPKVLELQV 522-703: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 703 | 703 | Centrosomal protein of 63 kDa | PRO_0000089493 | |||||
Regions | |||||||||
| Coiled coil | 22 – 199 | 178 | Potential | ||||||
| Coiled coil | 242 – 306 | 65 | Potential | ||||||
| Coiled coil | 353 – 533 | 181 | Potential | ||||||
| Coiled coil | 676 – 703 | 28 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 310 – 355 | 46 | Missing in isoform 3 and isoform 4. | VSP_012251 | |||||
| Alternative sequence | 490 – 651 | 162 | Missing in isoform 2 and isoform 3. | VSP_012252 | |||||
| Alternative sequence | 490 – 521 | 32 | AKEIS…QKDLM → RWGFTMLSSLVLNFGIQAIR QPQRPKVLELQV in isoform 4. | VSP_012253 | |||||
| Alternative sequence | 522 – 703 | 182 | Missing in isoform 4. | VSP_012254 | |||||
| Natural variant | 651 | 1 | S → L. Corresponds to variant rs1127826 [ dbSNP | Ensembl ]. | VAR_020604 | |||||
Experimental info | |||||||||
| Sequence conflict | 365 | 1 | K → R in BAB14662. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 4). Tissue: Placenta and Teratocarcinoma. |
| [2] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Pancreas. |
| [4] | "Proteomic characterization of the human centrosome by protein correlation profiling." Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M. Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION (ISOFORM 3), MASS SPECTROMETRY, SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS]. Tissue: Lymphoblast. |
| [5] | "Cep63 recruits Cdk1 to the centrosome: implications for regulation of mitotic entry, centrosome amplification, and genome maintenance." Loffler H., Fechter A., Matuszewska M., Saffrich R., Mistrik M., Marhold J., Hornung C., Westermann F., Bartek J., Kramer A. Cancer Res. 71:2129-2139(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDK1 AND CDK2, SUBCELLULAR LOCATION. |
| [6] | "A primary microcephaly protein complex forms a ring around parental centrioles." Sir J.H., Barr A.R., Nicholas A.K., Carvalho O.P., Khurshid M., Sossick A., Reichelt S., D'Santos C., Woods C.G., Gergely F. Nat. Genet. 43:1147-1153(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN SCKL6, FUNCTION, INTERACTION WITH CEP152, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK023448 mRNA. Translation: BAB14578.1. AK023738 mRNA. Translation: BAB14662.1. AK056465 mRNA. Translation: BAB71192.1. CH471052 Genomic DNA. Translation: EAW79136.1. CH471052 Genomic DNA. Translation: EAW79137.1. CH471052 Genomic DNA. Translation: EAW79138.1. CH471052 Genomic DNA. Translation: EAW79139.1. CH471052 Genomic DNA. Translation: EAW79140.1. CH471052 Genomic DNA. Translation: EAW79141.1. BC014050 mRNA. Translation: AAH14050.1. BC068997 mRNA. Translation: AAH68997.1. BK005503 mRNA. Translation: DAA05503.1. |
| IPI | IPI00018708. IPI00041779. IPI00043373. IPI00060568. |
| RefSeq | NP_001035842.1. NM_001042383.1. NP_001035843.1. NM_001042384.1. NP_001035859.1. NM_001042400.1. NP_079456.2. NM_025180.3. |
| UniGene | Hs.443301. |
3D structure databases | |
| ProteinModelPortal | Q96MT8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-36374N. |
| IntAct | Q96MT8. 18 interactions. |
| MINT | MINT-1443653. |
| STRING | 9606.ENSP00000336524. |
PTM databases | |
| PhosphoSite | Q96MT8. |
Polymorphism databases | |
| DMDM | 56748851. |
Proteomic databases | |
| PaxDb | Q96MT8. |
| PRIDE | Q96MT8. |
Protocols and materials databases | |
| DNASU | 80254. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000332047; ENSP00000328382; ENSG00000182923. ENST00000337090; ENSP00000336524; ENSG00000182923. ENST00000354446; ENSP00000346432; ENSG00000182923. ENST00000383229; ENSP00000372716; ENSG00000182923. ENST00000513612; ENSP00000426129; ENSG00000182923. |
| GeneID | 80254. |
| KEGG | hsa:80254. |
| UCSC | uc003eql.1. human. uc003eqm.3. human. uc003eqn.1. human. uc003eqo.1. human. |
Organism-specific databases | |
| CTD | 80254. |
| GeneCards | GC03P134204. |
| HGNC | HGNC:25815. CEP63. |
| MIM | 614724. gene. 614728. phenotype. |
| neXtProt | NX_Q96MT8. |
| Orphanet | 2512. Autosomal recessive primary microcephaly. |
| PharmGKB | PA142672124. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG116818. |
| InParanoid | Q96MT8. |
| KO | K16763. |
| OMA | YRAEIKK. |
| PhylomeDB | Q96MT8. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. |
Gene expression databases | |
| ArrayExpress | Q96MT8. |
| Bgee | Q96MT8. |
| CleanEx | HS_CEP63. |
| Genevestigator | Q96MT8. |
| GermOnline | ENSG00000182923. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CEP63. human. |
| GenomeRNAi | 80254. |
| NextBio | 70695. |
| SOURCE | Search... |
Entry information
| Entry name | CEP63_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MT8 Secondary accession number(s): D3DND8 Q9H8N0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
