SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MT1

- RN145_HUMAN

UniProt

Q96MT1 - RN145_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RING finger protein 145

Gene
RNF145
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5 - Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri537 – 57539RING-type; atypicalAdd
BLAST

GO - Molecular functioni

  1. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 145
Gene namesi
Name:RNF145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:20853. RNF145.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei53 – 7321Helical; Reviewed predictionAdd
BLAST
Transmembranei77 – 9721Helical; Reviewed predictionAdd
BLAST
Transmembranei123 – 14321Helical; Reviewed predictionAdd
BLAST
Transmembranei146 – 16621Helical; Reviewed predictionAdd
BLAST
Transmembranei168 – 18821Helical; Reviewed predictionAdd
BLAST
Transmembranei205 – 22218Helical; Reviewed predictionAdd
BLAST
Transmembranei225 – 24521Helical; Reviewed predictionAdd
BLAST
Transmembranei275 – 29521Helical; Reviewed predictionAdd
BLAST
Transmembranei316 – 33621Helical; Reviewed predictionAdd
BLAST
Transmembranei340 – 36021Helical; Reviewed predictionAdd
BLAST
Transmembranei384 – 40421Helical; Reviewed predictionAdd
BLAST
Transmembranei410 – 43021Helical; Reviewed predictionAdd
BLAST
Transmembranei460 – 48021Helical; Reviewed predictionAdd
BLAST
Transmembranei482 – 50221Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134876286.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 663663RING finger protein 145PRO_0000294024Add
BLAST

Proteomic databases

MaxQBiQ96MT1.
PaxDbiQ96MT1.
PRIDEiQ96MT1.

PTM databases

PhosphoSiteiQ96MT1.

Expressioni

Gene expression databases

ArrayExpressiQ96MT1.
BgeeiQ96MT1.
CleanExiHS_RNF145.
GenevestigatoriQ96MT1.

Organism-specific databases

HPAiHPA036562.

Interactioni

Protein-protein interaction databases

BioGridi127521. 2 interactions.
STRINGi9606.ENSP00000274542.

Structurei

3D structure databases

ProteinModelPortaliQ96MT1.
SMRiQ96MT1. Positions 535-574.

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri537 – 57539RING-type; atypicalAdd
BLAST

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiNOG246550.
HOGENOMiHOG000072697.
HOVERGENiHBG054921.
InParanoidiQ96MT1.
OMAiGAEQNVM.
OrthoDBiEOG7C5M8S.
PhylomeDBiQ96MT1.
TreeFamiTF318635.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96MT1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ    50
YKYLALNMHY VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY 100
VRSELEFAYE GPMYLEPLSM NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS 150
AHMLPLLARL CLVPLETIVI INKFAMIFTG LEVLYFLGSN LLVPYNLAKS 200
AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA LQIYSYFSTR 250
DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ 300
GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV 350
ASILQSMLEI ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI 400
CQFFHMDFWL LIIISSSILT SLQVLGTLFI YVLFMVEEFR KEPVENMDDV 450
IYYVNGTYRL LEFLVALCVV AYGVSETIFG EWTVMGSMII FIHSYYNVWL 500
RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC YQDMKSAVIT 550
PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE 600
QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP 650
HSAKDEAHPV ESA 663
Length:663
Mass (Da):75,617
Last modified:July 10, 2007 - v2
Checksum:iEAE984696500ABD3
GO
Isoform 2 (identifier: Q96MT1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM

Show »
Length:691
Mass (Da):78,905
Checksum:iB981A095846EB21D
GO
Isoform 3 (identifier: Q96MT1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEVVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:680
Mass (Da):77,635
Checksum:iC1F1EC3ECDDD18CC
GO
Isoform 4 (identifier: Q96MT1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:677
Mass (Da):77,335
Checksum:i14F56CB45C03474E
GO
Isoform 5 (identifier: Q96MT1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:693
Mass (Da):79,198
Checksum:iB31C1F06B683C778
GO

Sequence cautioni

The sequence AK308394 differs from that shown. Reason: Frameshift at position 189.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. VSP_037501
Alternative sequencei1 – 11M → MAEVVFSKKKKKKKKNNM in isoform 3. VSP_043661
Alternative sequencei1 – 11M → MVFSKKKKKKKKNNM in isoform 4. VSP_043662
Alternative sequencei1 – 11M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. VSP_044539

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti9 – 91A → V in AAH42684. 1 Publication
Sequence conflicti383 – 3831V → A in AAH42684. 1 Publication
Sequence conflicti501 – 5011R → W in AK308394. 1 Publication
Sequence conflicti657 – 6571A → V in AAH42684. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056513 mRNA. Translation: BAB71200.1.
AK304228 mRNA. Translation: BAH14139.1.
AK304435 mRNA. Translation: BAH14185.1.
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1.
CCDSiCCDS4344.1. [Q96MT1-2]
CCDS56390.1. [Q96MT1-1]
CCDS56391.1. [Q96MT1-4]
CCDS56392.1. [Q96MT1-3]
CCDS56393.1. [Q96MT1-5]
RefSeqiNP_001186309.1. NM_001199380.1. [Q96MT1-5]
NP_001186310.1. NM_001199381.1. [Q96MT1-3]
NP_001186311.1. NM_001199382.1. [Q96MT1-4]
NP_001186312.1. NM_001199383.1. [Q96MT1-1]
NP_653327.1. NM_144726.2. [Q96MT1-2]
UniGeneiHs.349306.

Genome annotation databases

EnsembliENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
GeneIDi153830.
KEGGihsa:153830.
UCSCiuc003lxo.2. human. [Q96MT1-2]
uc003lxp.3. human. [Q96MT1-1]
uc011ddy.2. human. [Q96MT1-4]
uc011ddz.2. human. [Q96MT1-3]

Polymorphism databases

DMDMi152060502.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056513 mRNA. Translation: BAB71200.1 .
AK304228 mRNA. Translation: BAH14139.1 .
AK304435 mRNA. Translation: BAH14185.1 .
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1 .
CCDSi CCDS4344.1. [Q96MT1-2 ]
CCDS56390.1. [Q96MT1-1 ]
CCDS56391.1. [Q96MT1-4 ]
CCDS56392.1. [Q96MT1-3 ]
CCDS56393.1. [Q96MT1-5 ]
RefSeqi NP_001186309.1. NM_001199380.1. [Q96MT1-5 ]
NP_001186310.1. NM_001199381.1. [Q96MT1-3 ]
NP_001186311.1. NM_001199382.1. [Q96MT1-4 ]
NP_001186312.1. NM_001199383.1. [Q96MT1-1 ]
NP_653327.1. NM_144726.2. [Q96MT1-2 ]
UniGenei Hs.349306.

3D structure databases

ProteinModelPortali Q96MT1.
SMRi Q96MT1. Positions 535-574.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127521. 2 interactions.
STRINGi 9606.ENSP00000274542.

PTM databases

PhosphoSitei Q96MT1.

Polymorphism databases

DMDMi 152060502.

Proteomic databases

MaxQBi Q96MT1.
PaxDbi Q96MT1.
PRIDEi Q96MT1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000274542 ; ENSP00000274542 ; ENSG00000145860 . [Q96MT1-2 ]
ENST00000424310 ; ENSP00000409064 ; ENSG00000145860 . [Q96MT1-1 ]
ENST00000518802 ; ENSP00000430955 ; ENSG00000145860 . [Q96MT1-5 ]
ENST00000519865 ; ENSP00000430397 ; ENSG00000145860 . [Q96MT1-1 ]
ENST00000520638 ; ENSP00000429071 ; ENSG00000145860 . [Q96MT1-4 ]
ENST00000521606 ; ENSP00000430753 ; ENSG00000145860 . [Q96MT1-3 ]
GeneIDi 153830.
KEGGi hsa:153830.
UCSCi uc003lxo.2. human. [Q96MT1-2 ]
uc003lxp.3. human. [Q96MT1-1 ]
uc011ddy.2. human. [Q96MT1-4 ]
uc011ddz.2. human. [Q96MT1-3 ]

Organism-specific databases

CTDi 153830.
GeneCardsi GC05M158517.
HGNCi HGNC:20853. RNF145.
HPAi HPA036562.
neXtProti NX_Q96MT1.
PharmGKBi PA134876286.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246550.
HOGENOMi HOG000072697.
HOVERGENi HBG054921.
InParanoidi Q96MT1.
OMAi GAEQNVM.
OrthoDBi EOG7C5M8S.
PhylomeDBi Q96MT1.
TreeFami TF318635.

Miscellaneous databases

GenomeRNAii 153830.
NextBioi 87196.
PROi Q96MT1.

Gene expression databases

ArrayExpressi Q96MT1.
Bgeei Q96MT1.
CleanExi HS_RNF145.
Genevestigatori Q96MT1.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view ]
SMARTi SM00184. RING. 1 hit.
[Graphical view ]
PROSITEi PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Trachea.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiRN145_HUMAN
AccessioniPrimary (citable) accession number: Q96MT1
Secondary accession number(s): B7Z903
, B7Z949, E7EVI7, Q8IVP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi