Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96MT1

- RN145_HUMAN

UniProt

Q96MT1 - RN145_HUMAN

Protein

RING finger protein 145

Gene

RNF145

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 2 (10 Jul 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri537 – 57539RING-type; atypicalPROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RING finger protein 145
    Gene namesi
    Name:RNF145
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:20853. RNF145.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134876286.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 663663RING finger protein 145PRO_0000294024Add
    BLAST

    Proteomic databases

    MaxQBiQ96MT1.
    PaxDbiQ96MT1.
    PRIDEiQ96MT1.

    PTM databases

    PhosphoSiteiQ96MT1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96MT1.
    BgeeiQ96MT1.
    CleanExiHS_RNF145.
    GenevestigatoriQ96MT1.

    Organism-specific databases

    HPAiHPA036562.

    Interactioni

    Protein-protein interaction databases

    BioGridi127521. 2 interactions.
    STRINGi9606.ENSP00000274542.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96MT1.
    SMRiQ96MT1. Positions 535-574.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei53 – 7321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei77 – 9721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei123 – 14321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei146 – 16621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei168 – 18821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei205 – 22218HelicalSequence AnalysisAdd
    BLAST
    Transmembranei225 – 24521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei275 – 29521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei316 – 33621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei340 – 36021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei384 – 40421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei410 – 43021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei460 – 48021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei482 – 50221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri537 – 57539RING-type; atypicalPROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Transmembrane, Transmembrane helix, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG246550.
    HOGENOMiHOG000072697.
    HOVERGENiHBG054921.
    InParanoidiQ96MT1.
    OMAiGAEQNVM.
    OrthoDBiEOG7C5M8S.
    PhylomeDBiQ96MT1.
    TreeFamiTF318635.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR025754. TRC8_N_dom.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF13705. TRC8_N. 1 hit.
    PF13639. zf-RING_2. 1 hit.
    [Graphical view]
    SMARTiSM00184. RING. 1 hit.
    [Graphical view]
    PROSITEiPS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96MT1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ    50
    YKYLALNMHY VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY 100
    VRSELEFAYE GPMYLEPLSM NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS 150
    AHMLPLLARL CLVPLETIVI INKFAMIFTG LEVLYFLGSN LLVPYNLAKS 200
    AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA LQIYSYFSTR 250
    DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ 300
    GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV 350
    ASILQSMLEI ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI 400
    CQFFHMDFWL LIIISSSILT SLQVLGTLFI YVLFMVEEFR KEPVENMDDV 450
    IYYVNGTYRL LEFLVALCVV AYGVSETIFG EWTVMGSMII FIHSYYNVWL 500
    RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC YQDMKSAVIT 550
    PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE 600
    QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP 650
    HSAKDEAHPV ESA 663
    Length:663
    Mass (Da):75,617
    Last modified:July 10, 2007 - v2
    Checksum:iEAE984696500ABD3
    GO
    Isoform 2 (identifier: Q96MT1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM

    Show »
    Length:691
    Mass (Da):78,905
    Checksum:iB981A095846EB21D
    GO
    Isoform 3 (identifier: Q96MT1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MAEVVFSKKKKKKKKNNM

    Note: No experimental confirmation available.

    Show »
    Length:680
    Mass (Da):77,635
    Checksum:iC1F1EC3ECDDD18CC
    GO
    Isoform 4 (identifier: Q96MT1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MVFSKKKKKKKKNNM

    Note: No experimental confirmation available.

    Show »
    Length:677
    Mass (Da):77,335
    Checksum:i14F56CB45C03474E
    GO
    Isoform 5 (identifier: Q96MT1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM

    Note: No experimental confirmation available.

    Show »
    Length:693
    Mass (Da):79,198
    Checksum:iB31C1F06B683C778
    GO

    Sequence cautioni

    The sequence AK308394 differs from that shown. Reason: Frameshift at position 189.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti9 – 91A → V in AAH42684. (PubMed:15489334)Curated
    Sequence conflicti383 – 3831V → A in AAH42684. (PubMed:15489334)Curated
    Sequence conflicti501 – 5011R → W in AK308394. (PubMed:14702039)Curated
    Sequence conflicti657 – 6571A → V in AAH42684. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. 1 PublicationVSP_037501
    Alternative sequencei1 – 11M → MAEVVFSKKKKKKKKNNM in isoform 3. 1 PublicationVSP_043661
    Alternative sequencei1 – 11M → MVFSKKKKKKKKNNM in isoform 4. 1 PublicationVSP_043662
    Alternative sequencei1 – 11M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. 1 PublicationVSP_044539

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056513 mRNA. Translation: BAB71200.1.
    AK304228 mRNA. Translation: BAH14139.1.
    AK304435 mRNA. Translation: BAH14185.1.
    AK308394 mRNA. No translation available.
    AC134043 Genomic DNA. No translation available.
    BC042684 mRNA. Translation: AAH42684.1.
    CCDSiCCDS4344.1. [Q96MT1-2]
    CCDS56390.1. [Q96MT1-1]
    CCDS56391.1. [Q96MT1-4]
    CCDS56392.1. [Q96MT1-3]
    CCDS56393.1. [Q96MT1-5]
    RefSeqiNP_001186309.1. NM_001199380.1. [Q96MT1-5]
    NP_001186310.1. NM_001199381.1. [Q96MT1-3]
    NP_001186311.1. NM_001199382.1. [Q96MT1-4]
    NP_001186312.1. NM_001199383.1. [Q96MT1-1]
    NP_653327.1. NM_144726.2. [Q96MT1-2]
    UniGeneiHs.349306.

    Genome annotation databases

    EnsembliENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
    ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
    ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
    ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
    ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
    ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
    GeneIDi153830.
    KEGGihsa:153830.
    UCSCiuc003lxo.2. human. [Q96MT1-2]
    uc003lxp.3. human. [Q96MT1-1]
    uc011ddy.2. human. [Q96MT1-4]
    uc011ddz.2. human. [Q96MT1-3]

    Polymorphism databases

    DMDMi152060502.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056513 mRNA. Translation: BAB71200.1 .
    AK304228 mRNA. Translation: BAH14139.1 .
    AK304435 mRNA. Translation: BAH14185.1 .
    AK308394 mRNA. No translation available.
    AC134043 Genomic DNA. No translation available.
    BC042684 mRNA. Translation: AAH42684.1 .
    CCDSi CCDS4344.1. [Q96MT1-2 ]
    CCDS56390.1. [Q96MT1-1 ]
    CCDS56391.1. [Q96MT1-4 ]
    CCDS56392.1. [Q96MT1-3 ]
    CCDS56393.1. [Q96MT1-5 ]
    RefSeqi NP_001186309.1. NM_001199380.1. [Q96MT1-5 ]
    NP_001186310.1. NM_001199381.1. [Q96MT1-3 ]
    NP_001186311.1. NM_001199382.1. [Q96MT1-4 ]
    NP_001186312.1. NM_001199383.1. [Q96MT1-1 ]
    NP_653327.1. NM_144726.2. [Q96MT1-2 ]
    UniGenei Hs.349306.

    3D structure databases

    ProteinModelPortali Q96MT1.
    SMRi Q96MT1. Positions 535-574.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127521. 2 interactions.
    STRINGi 9606.ENSP00000274542.

    PTM databases

    PhosphoSitei Q96MT1.

    Polymorphism databases

    DMDMi 152060502.

    Proteomic databases

    MaxQBi Q96MT1.
    PaxDbi Q96MT1.
    PRIDEi Q96MT1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000274542 ; ENSP00000274542 ; ENSG00000145860 . [Q96MT1-2 ]
    ENST00000424310 ; ENSP00000409064 ; ENSG00000145860 . [Q96MT1-1 ]
    ENST00000518802 ; ENSP00000430955 ; ENSG00000145860 . [Q96MT1-5 ]
    ENST00000519865 ; ENSP00000430397 ; ENSG00000145860 . [Q96MT1-1 ]
    ENST00000520638 ; ENSP00000429071 ; ENSG00000145860 . [Q96MT1-4 ]
    ENST00000521606 ; ENSP00000430753 ; ENSG00000145860 . [Q96MT1-3 ]
    GeneIDi 153830.
    KEGGi hsa:153830.
    UCSCi uc003lxo.2. human. [Q96MT1-2 ]
    uc003lxp.3. human. [Q96MT1-1 ]
    uc011ddy.2. human. [Q96MT1-4 ]
    uc011ddz.2. human. [Q96MT1-3 ]

    Organism-specific databases

    CTDi 153830.
    GeneCardsi GC05M158517.
    HGNCi HGNC:20853. RNF145.
    HPAi HPA036562.
    neXtProti NX_Q96MT1.
    PharmGKBi PA134876286.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG246550.
    HOGENOMi HOG000072697.
    HOVERGENi HBG054921.
    InParanoidi Q96MT1.
    OMAi GAEQNVM.
    OrthoDBi EOG7C5M8S.
    PhylomeDBi Q96MT1.
    TreeFami TF318635.

    Miscellaneous databases

    GenomeRNAii 153830.
    NextBioi 87196.
    PROi Q96MT1.

    Gene expression databases

    ArrayExpressi Q96MT1.
    Bgeei Q96MT1.
    CleanExi HS_RNF145.
    Genevestigatori Q96MT1.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR025754. TRC8_N_dom.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF13705. TRC8_N. 1 hit.
    PF13639. zf-RING_2. 1 hit.
    [Graphical view ]
    SMARTi SM00184. RING. 1 hit.
    [Graphical view ]
    PROSITEi PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
      Tissue: Trachea.
    2. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.

    Entry informationi

    Entry nameiRN145_HUMAN
    AccessioniPrimary (citable) accession number: Q96MT1
    Secondary accession number(s): B7Z903
    , B7Z949, E7EVI7, Q8IVP7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 10, 2007
    Last sequence update: July 10, 2007
    Last modified: October 1, 2014
    This is version 105 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3