Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96MT1 (RN145_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RING finger protein 145
Gene names
Name:RNF145
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length663 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Contains 1 RING-type zinc finger.

Sequence caution

The sequence AK308394 differs from that shown. Reason: Frameshift at position 189.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
Zinc-finger
   LigandMetal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionzinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96MT1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96MT1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM
Isoform 3 (identifier: Q96MT1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEVVFSKKKKKKKKNNM
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96MT1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFSKKKKKKKKNNM
Note: No experimental confirmation available.
Isoform 5 (identifier: Q96MT1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 663663RING finger protein 145
PRO_0000294024

Regions

Transmembrane53 – 7321Helical; Potential
Transmembrane77 – 9721Helical; Potential
Transmembrane123 – 14321Helical; Potential
Transmembrane146 – 16621Helical; Potential
Transmembrane168 – 18821Helical; Potential
Transmembrane205 – 22218Helical; Potential
Transmembrane225 – 24521Helical; Potential
Transmembrane275 – 29521Helical; Potential
Transmembrane316 – 33621Helical; Potential
Transmembrane340 – 36021Helical; Potential
Transmembrane384 – 40421Helical; Potential
Transmembrane410 – 43021Helical; Potential
Transmembrane460 – 48021Helical; Potential
Transmembrane482 – 50221Helical; Potential
Zinc finger537 – 57539RING-type; atypical

Natural variations

Alternative sequence11M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2.
VSP_037501
Alternative sequence11M → MAEVVFSKKKKKKKKNNM in isoform 3.
VSP_043661
Alternative sequence11M → MVFSKKKKKKKKNNM in isoform 4.
VSP_043662
Alternative sequence11M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5.
VSP_044539

Experimental info

Sequence conflict91A → V in AAH42684. Ref.3
Sequence conflict3831V → A in AAH42684. Ref.3
Sequence conflict5011R → W in AK308394. Ref.1
Sequence conflict6571A → V in AAH42684. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 10, 2007. Version 2.
Checksum: EAE984696500ABD3

FASTA66375,617
        10         20         30         40         50         60 
MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ YKYLALNMHY 

        70         80         90        100        110        120 
VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY VRSELEFAYE GPMYLEPLSM 

       130        140        150        160        170        180 
NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS AHMLPLLARL CLVPLETIVI INKFAMIFTG 

       190        200        210        220        230        240 
LEVLYFLGSN LLVPYNLAKS AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA 

       250        260        270        280        290        300 
LQIYSYFSTR DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ 

       310        320        330        340        350        360 
GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV ASILQSMLEI 

       370        380        390        400        410        420 
ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI CQFFHMDFWL LIIISSSILT 

       430        440        450        460        470        480 
SLQVLGTLFI YVLFMVEEFR KEPVENMDDV IYYVNGTYRL LEFLVALCVV AYGVSETIFG 

       490        500        510        520        530        540 
EWTVMGSMII FIHSYYNVWL RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC 

       550        560        570        580        590        600 
YQDMKSAVIT PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE 

       610        620        630        640        650        660 
QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP HSAKDEAHPV 


ESA 

« Hide

Isoform 2 [UniParc].

Checksum: B981A095846EB21D
Show »

FASTA69178,905
Isoform 3 [UniParc].

Checksum: C1F1EC3ECDDD18CC
Show »

FASTA68077,635
Isoform 4 [UniParc].

Checksum: 14F56CB45C03474E
Show »

FASTA67777,335
Isoform 5 [UniParc].

Checksum: B31C1F06B683C778
Show »

FASTA69379,198

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
Tissue: Trachea.
[2]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK056513 mRNA. Translation: BAB71200.1.
AK304228 mRNA. Translation: BAH14139.1.
AK304435 mRNA. Translation: BAH14185.1.
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1.
CCDSCCDS4344.1. [Q96MT1-2]
CCDS56390.1. [Q96MT1-1]
CCDS56391.1. [Q96MT1-4]
CCDS56392.1. [Q96MT1-3]
CCDS56393.1. [Q96MT1-5]
RefSeqNP_001186309.1. NM_001199380.1. [Q96MT1-5]
NP_001186310.1. NM_001199381.1. [Q96MT1-3]
NP_001186311.1. NM_001199382.1. [Q96MT1-4]
NP_001186312.1. NM_001199383.1. [Q96MT1-1]
NP_653327.1. NM_144726.2. [Q96MT1-2]
UniGeneHs.349306.

3D structure databases

ProteinModelPortalQ96MT1.
SMRQ96MT1. Positions 535-574.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127521. 2 interactions.
STRING9606.ENSP00000274542.

PTM databases

PhosphoSiteQ96MT1.

Polymorphism databases

DMDM152060502.

Proteomic databases

MaxQBQ96MT1.
PaxDbQ96MT1.
PRIDEQ96MT1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
GeneID153830.
KEGGhsa:153830.
UCSCuc003lxo.2. human. [Q96MT1-2]
uc003lxp.3. human. [Q96MT1-1]
uc011ddy.2. human. [Q96MT1-4]
uc011ddz.2. human. [Q96MT1-3]

Organism-specific databases

CTD153830.
GeneCardsGC05M158517.
HGNCHGNC:20853. RNF145.
HPAHPA036562.
neXtProtNX_Q96MT1.
PharmGKBPA134876286.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG246550.
HOGENOMHOG000072697.
HOVERGENHBG054921.
InParanoidQ96MT1.
OMAGAEQNVM.
OrthoDBEOG7C5M8S.
PhylomeDBQ96MT1.
TreeFamTF318635.

Gene expression databases

ArrayExpressQ96MT1.
BgeeQ96MT1.
CleanExHS_RNF145.
GenevestigatorQ96MT1.

Family and domain databases

Gene3D3.30.40.10. 1 hit.
InterProIPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamPF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTSM00184. RING. 1 hit.
[Graphical view]
PROSITEPS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi153830.
NextBio87196.
PROQ96MT1.

Entry information

Entry nameRN145_HUMAN
AccessionPrimary (citable) accession number: Q96MT1
Secondary accession number(s): B7Z903 expand/collapse secondary AC list , B7Z949, E7EVI7, Q8IVP7
Entry history
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: July 9, 2014
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM