Q96MT1 (RN145_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RING finger protein 145 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 663 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Contains 1 RING-type zinc finger. |
| Sequence caution | The sequence AK308394 differs from that shown. Reason: Frameshift at position 189. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix Zinc-finger |
| Ligand | Metal-binding Zinc |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MT1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96MT1-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM | ||||||
| Isoform 3 (identifier: Q96MT1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAEVVFSKKKKKKKKNNM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q96MT1-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MVFSKKKKKKKKNNM | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q96MT1-5) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 663 | 663 | RING finger protein 145 | PRO_0000294024 | |||||
Regions | |||||||||
| Transmembrane | 53 – 73 | 21 | Helical; Potential | ||||||
| Transmembrane | 77 – 97 | 21 | Helical; Potential | ||||||
| Transmembrane | 123 – 143 | 21 | Helical; Potential | ||||||
| Transmembrane | 146 – 166 | 21 | Helical; Potential | ||||||
| Transmembrane | 168 – 188 | 21 | Helical; Potential | ||||||
| Transmembrane | 205 – 222 | 18 | Helical; Potential | ||||||
| Transmembrane | 225 – 245 | 21 | Helical; Potential | ||||||
| Transmembrane | 275 – 295 | 21 | Helical; Potential | ||||||
| Transmembrane | 316 – 336 | 21 | Helical; Potential | ||||||
| Transmembrane | 340 – 360 | 21 | Helical; Potential | ||||||
| Transmembrane | 384 – 404 | 21 | Helical; Potential | ||||||
| Transmembrane | 410 – 430 | 21 | Helical; Potential | ||||||
| Transmembrane | 460 – 480 | 21 | Helical; Potential | ||||||
| Transmembrane | 482 – 502 | 21 | Helical; Potential | ||||||
| Zinc finger | 537 – 575 | 39 | RING-type; atypical | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. | VSP_037501 | |||||
| Alternative sequence | 1 | 1 | M → MAEVVFSKKKKKKKKNNM in isoform 3. | VSP_043661 | |||||
| Alternative sequence | 1 | 1 | M → MVFSKKKKKKKKNNM in isoform 4. | VSP_043662 | |||||
| Alternative sequence | 1 | 1 | M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. | VSP_044539 | |||||
Experimental info | |||||||||
| Sequence conflict | 9 | 1 | A → V in AAH42684. Ref.3 | ||||||
| Sequence conflict | 383 | 1 | V → A in AAH42684. Ref.3 | ||||||
| Sequence conflict | 501 | 1 | R → W in AK308394. Ref.1 | ||||||
| Sequence conflict | 657 | 1 | A → V in AAH42684. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5). Tissue: Trachea. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK056513 mRNA. Translation: BAB71200.1. AK304228 mRNA. Translation: BAH14139.1. AK304435 mRNA. Translation: BAH14185.1. AK308394 mRNA. No translation available. AC134043 Genomic DNA. No translation available. BC042684 mRNA. Translation: AAH42684.1. |
| IPI | IPI00043360. IPI00930398. IPI00975659. IPI00976259. IPI00979590. |
| RefSeq | NP_001186309.1. NM_001199380.1. NP_001186310.1. NM_001199381.1. NP_001186311.1. NM_001199382.1. NP_001186312.1. NM_001199383.1. NP_653327.1. NM_144726.2. |
| UniGene | Hs.349306. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1X4J based on UniProtKB Q9H0F5. |
| ProteinModelPortal | Q96MT1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000274542. |
PTM databases | |
| PhosphoSite | Q96MT1. |
Polymorphism databases | |
| DMDM | 152060502. |
Proteomic databases | |
| PaxDb | Q96MT1. |
| PRIDE | Q96MT1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000274542; ENSP00000274542; ENSG00000145860. ENST00000413445; ENSP00000445115; ENSG00000145860. ENST00000424310; ENSP00000409064; ENSG00000145860. ENST00000518802; ENSP00000430955; ENSG00000145860. ENST00000519865; ENSP00000430397; ENSG00000145860. ENST00000520638; ENSP00000429071; ENSG00000145860. ENST00000535312; ENSP00000442941; ENSG00000145860. |
| GeneID | 153830. |
| KEGG | hsa:153830. |
| UCSC | uc003lxo.2. human. uc003lxp.3. human. |
Organism-specific databases | |
| CTD | 153830. |
| GeneCards | GC05M158517. |
| HGNC | HGNC:20853. RNF145. |
| HPA | HPA036562. |
| neXtProt | NX_Q96MT1. |
| PharmGKB | PA134876286. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG246550. |
| HOGENOM | HOG000072697. |
| HOVERGEN | HBG054921. |
| InParanoid | Q96MT1. |
| OMA | AGAEQNV. |
| OrthoDB | EOG4BCDMJ. |
Gene expression databases | |
| ArrayExpress | Q96MT1. |
| Bgee | Q96MT1. |
| CleanEx | HS_RNF145. |
| Genevestigator | Q96MT1. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR025754. TRC8_N_dom. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF13705. TRC8_N. 1 hit. PF13639. zf-RING_2. 1 hit. [Graphical view] |
| SMART | SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 153830. |
| NextBio | 87196. |
Entry information
| Entry name | RN145_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MT1 Secondary accession number(s): B7Z903 Q8IVP7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
