Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RING finger protein 145

Gene

RNF145

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri537 – 575RING-type; atypicalPROSITE-ProRule annotationAdd BLAST39

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000145860-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 145
Gene namesi
Name:RNF145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:20853. RNF145.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei53 – 73HelicalSequence analysisAdd BLAST21
Transmembranei77 – 97HelicalSequence analysisAdd BLAST21
Transmembranei123 – 143HelicalSequence analysisAdd BLAST21
Transmembranei146 – 166HelicalSequence analysisAdd BLAST21
Transmembranei168 – 188HelicalSequence analysisAdd BLAST21
Transmembranei205 – 222HelicalSequence analysisAdd BLAST18
Transmembranei225 – 245HelicalSequence analysisAdd BLAST21
Transmembranei275 – 295HelicalSequence analysisAdd BLAST21
Transmembranei316 – 336HelicalSequence analysisAdd BLAST21
Transmembranei340 – 360HelicalSequence analysisAdd BLAST21
Transmembranei384 – 404HelicalSequence analysisAdd BLAST21
Transmembranei410 – 430HelicalSequence analysisAdd BLAST21
Transmembranei460 – 480HelicalSequence analysisAdd BLAST21
Transmembranei482 – 502HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi153830.
OpenTargetsiENSG00000145860.
PharmGKBiPA134876286.

Polymorphism and mutation databases

BioMutaiRNF145.
DMDMi152060502.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002940241 – 663RING finger protein 145Add BLAST663

Proteomic databases

MaxQBiQ96MT1.
PaxDbiQ96MT1.
PeptideAtlasiQ96MT1.
PRIDEiQ96MT1.

PTM databases

iPTMnetiQ96MT1.
PhosphoSitePlusiQ96MT1.

Expressioni

Gene expression databases

BgeeiENSG00000145860.
CleanExiHS_RNF145.
GenevisibleiQ96MT1. HS.

Organism-specific databases

HPAiHPA036562.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000430955.

Structurei

3D structure databases

ProteinModelPortaliQ96MT1.
SMRiQ96MT1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri537 – 575RING-type; atypicalPROSITE-ProRule annotationAdd BLAST39

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG0802. Eukaryota.
COG5243. LUCA.
GeneTreeiENSGT00530000062938.
HOGENOMiHOG000072697.
HOVERGENiHBG054921.
InParanoidiQ96MT1.
OMAiGAEQNVM.
OrthoDBiEOG091G020N.
PhylomeDBiQ96MT1.
TreeFamiTF318635.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR011016. Znf_RING-CH.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
SM00744. RINGv. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ
60 70 80 90 100
YKYLALNMHY VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY
110 120 130 140 150
VRSELEFAYE GPMYLEPLSM NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS
160 170 180 190 200
AHMLPLLARL CLVPLETIVI INKFAMIFTG LEVLYFLGSN LLVPYNLAKS
210 220 230 240 250
AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA LQIYSYFSTR
260 270 280 290 300
DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ
310 320 330 340 350
GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV
360 370 380 390 400
ASILQSMLEI ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI
410 420 430 440 450
CQFFHMDFWL LIIISSSILT SLQVLGTLFI YVLFMVEEFR KEPVENMDDV
460 470 480 490 500
IYYVNGTYRL LEFLVALCVV AYGVSETIFG EWTVMGSMII FIHSYYNVWL
510 520 530 540 550
RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC YQDMKSAVIT
560 570 580 590 600
PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE
610 620 630 640 650
QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP
660
HSAKDEAHPV ESA
Length:663
Mass (Da):75,617
Last modified:July 10, 2007 - v2
Checksum:iEAE984696500ABD3
GO
Isoform 2 (identifier: Q96MT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM

Show »
Length:691
Mass (Da):78,905
Checksum:iB981A095846EB21D
GO
Isoform 3 (identifier: Q96MT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEVVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:680
Mass (Da):77,635
Checksum:iC1F1EC3ECDDD18CC
GO
Isoform 4 (identifier: Q96MT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:677
Mass (Da):77,335
Checksum:i14F56CB45C03474E
GO
Isoform 5 (identifier: Q96MT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM

Note: No experimental confirmation available.
Show »
Length:693
Mass (Da):79,198
Checksum:iB31C1F06B683C778
GO

Sequence cautioni

The sequence AK308394 differs from that shown. Reason: Frameshift at position 189.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti9A → V in AAH42684 (PubMed:15489334).Curated1
Sequence conflicti383V → A in AAH42684 (PubMed:15489334).Curated1
Sequence conflicti501R → W in AK308394 (PubMed:14702039).Curated1
Sequence conflicti657A → V in AAH42684 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0375011M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. 1 Publication1
Alternative sequenceiVSP_0436611M → MAEVVFSKKKKKKKKNNM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0436621M → MVFSKKKKKKKKNNM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0445391M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056513 mRNA. Translation: BAB71200.1.
AK304228 mRNA. Translation: BAH14139.1.
AK304435 mRNA. Translation: BAH14185.1.
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1.
CCDSiCCDS4344.1. [Q96MT1-2]
CCDS56390.1. [Q96MT1-1]
CCDS56391.1. [Q96MT1-4]
CCDS56392.1. [Q96MT1-3]
CCDS56393.1. [Q96MT1-5]
RefSeqiNP_001186309.1. NM_001199380.1. [Q96MT1-5]
NP_001186310.1. NM_001199381.1. [Q96MT1-3]
NP_001186311.1. NM_001199382.1. [Q96MT1-4]
NP_001186312.1. NM_001199383.1. [Q96MT1-1]
NP_653327.1. NM_144726.2. [Q96MT1-2]
XP_016864627.1. XM_017009138.1. [Q96MT1-1]
UniGeneiHs.349306.

Genome annotation databases

EnsembliENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
ENST00000611185; ENSP00000482720; ENSG00000145860. [Q96MT1-1]
GeneIDi153830.
KEGGihsa:153830.
UCSCiuc003lxo.2. human. [Q96MT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056513 mRNA. Translation: BAB71200.1.
AK304228 mRNA. Translation: BAH14139.1.
AK304435 mRNA. Translation: BAH14185.1.
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1.
CCDSiCCDS4344.1. [Q96MT1-2]
CCDS56390.1. [Q96MT1-1]
CCDS56391.1. [Q96MT1-4]
CCDS56392.1. [Q96MT1-3]
CCDS56393.1. [Q96MT1-5]
RefSeqiNP_001186309.1. NM_001199380.1. [Q96MT1-5]
NP_001186310.1. NM_001199381.1. [Q96MT1-3]
NP_001186311.1. NM_001199382.1. [Q96MT1-4]
NP_001186312.1. NM_001199383.1. [Q96MT1-1]
NP_653327.1. NM_144726.2. [Q96MT1-2]
XP_016864627.1. XM_017009138.1. [Q96MT1-1]
UniGeneiHs.349306.

3D structure databases

ProteinModelPortaliQ96MT1.
SMRiQ96MT1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000430955.

PTM databases

iPTMnetiQ96MT1.
PhosphoSitePlusiQ96MT1.

Polymorphism and mutation databases

BioMutaiRNF145.
DMDMi152060502.

Proteomic databases

MaxQBiQ96MT1.
PaxDbiQ96MT1.
PeptideAtlasiQ96MT1.
PRIDEiQ96MT1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
ENST00000611185; ENSP00000482720; ENSG00000145860. [Q96MT1-1]
GeneIDi153830.
KEGGihsa:153830.
UCSCiuc003lxo.2. human. [Q96MT1-1]

Organism-specific databases

CTDi153830.
DisGeNETi153830.
GeneCardsiRNF145.
HGNCiHGNC:20853. RNF145.
HPAiHPA036562.
neXtProtiNX_Q96MT1.
OpenTargetsiENSG00000145860.
PharmGKBiPA134876286.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0802. Eukaryota.
COG5243. LUCA.
GeneTreeiENSGT00530000062938.
HOGENOMiHOG000072697.
HOVERGENiHBG054921.
InParanoidiQ96MT1.
OMAiGAEQNVM.
OrthoDBiEOG091G020N.
PhylomeDBiQ96MT1.
TreeFamiTF318635.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000145860-MONOMER.

Miscellaneous databases

ChiTaRSiRNF145. human.
GenomeRNAii153830.
PROiQ96MT1.

Gene expression databases

BgeeiENSG00000145860.
CleanExiHS_RNF145.
GenevisibleiQ96MT1. HS.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR011016. Znf_RING-CH.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
SM00744. RINGv. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRN145_HUMAN
AccessioniPrimary (citable) accession number: Q96MT1
Secondary accession number(s): B7Z903
, B7Z949, E7EVI7, Q8IVP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: November 2, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.