Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MT1

- RN145_HUMAN

UniProt

Q96MT1 - RN145_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RING finger protein 145

Gene

RNF145

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri537 – 57539RING-type; atypicalPROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 145
Gene namesi
Name:RNF145
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:20853. RNF145.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei53 – 7321HelicalSequence AnalysisAdd
BLAST
Transmembranei77 – 9721HelicalSequence AnalysisAdd
BLAST
Transmembranei123 – 14321HelicalSequence AnalysisAdd
BLAST
Transmembranei146 – 16621HelicalSequence AnalysisAdd
BLAST
Transmembranei168 – 18821HelicalSequence AnalysisAdd
BLAST
Transmembranei205 – 22218HelicalSequence AnalysisAdd
BLAST
Transmembranei225 – 24521HelicalSequence AnalysisAdd
BLAST
Transmembranei275 – 29521HelicalSequence AnalysisAdd
BLAST
Transmembranei316 – 33621HelicalSequence AnalysisAdd
BLAST
Transmembranei340 – 36021HelicalSequence AnalysisAdd
BLAST
Transmembranei384 – 40421HelicalSequence AnalysisAdd
BLAST
Transmembranei410 – 43021HelicalSequence AnalysisAdd
BLAST
Transmembranei460 – 48021HelicalSequence AnalysisAdd
BLAST
Transmembranei482 – 50221HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134876286.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 663663RING finger protein 145PRO_0000294024Add
BLAST

Proteomic databases

MaxQBiQ96MT1.
PaxDbiQ96MT1.
PRIDEiQ96MT1.

PTM databases

PhosphoSiteiQ96MT1.

Expressioni

Gene expression databases

BgeeiQ96MT1.
CleanExiHS_RNF145.
ExpressionAtlasiQ96MT1. baseline and differential.
GenevestigatoriQ96MT1.

Organism-specific databases

HPAiHPA036562.

Interactioni

Protein-protein interaction databases

BioGridi127521. 2 interactions.
STRINGi9606.ENSP00000274542.

Structurei

3D structure databases

ProteinModelPortaliQ96MT1.
SMRiQ96MT1. Positions 535-574.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri537 – 57539RING-type; atypicalPROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiNOG246550.
GeneTreeiENSGT00530000062938.
HOGENOMiHOG000072697.
HOVERGENiHBG054921.
InParanoidiQ96MT1.
OMAiGAEQNVM.
OrthoDBiEOG7C5M8S.
PhylomeDBiQ96MT1.
TreeFamiTF318635.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96MT1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAKEKLEAV LNVALRVPSI MLLDVLYRWD VSSFFQQIQR SSLSNNPLFQ
60 70 80 90 100
YKYLALNMHY VGYILSVVLL TLPRQHLVQL YLYFLTALLL YAGHQISRDY
110 120 130 140 150
VRSELEFAYE GPMYLEPLSM NRFTTALIGQ LVVCTLCSCV MKTKQIWLFS
160 170 180 190 200
AHMLPLLARL CLVPLETIVI INKFAMIFTG LEVLYFLGSN LLVPYNLAKS
210 220 230 240 250
AYRELVQVVE VYGLLALGMS LWNQLVVPVL FMVFWLVLFA LQIYSYFSTR
260 270 280 290 300
DQPASRERLL FLFLTSIAEC CSTPYSLLGL VFTVSFVALG VLTLCKFYLQ
310 320 330 340 350
GYRAFMNDPA MNRGMTEGVT LLILAVQTGL IELQVVHRAF LLSIILFIVV
360 370 380 390 400
ASILQSMLEI ADPIVLALGA SRDKSLWKHF RAVSLCLFLL VFPAYMAYMI
410 420 430 440 450
CQFFHMDFWL LIIISSSILT SLQVLGTLFI YVLFMVEEFR KEPVENMDDV
460 470 480 490 500
IYYVNGTYRL LEFLVALCVV AYGVSETIFG EWTVMGSMII FIHSYYNVWL
510 520 530 540 550
RAQLGWKSFL LRRDAVNKIK SLPIATKEQL EKHNDICAIC YQDMKSAVIT
560 570 580 590 600
PCSHFFHAGC LKKWLYVQET CPLCHCHLKN SSQLPGLGTE PVLQPHAGAE
610 620 630 640 650
QNVMFQEGTE PPGQEHTPGT RIQEGSRDNN EYIARRPDNQ EGAFDPKEYP
660
HSAKDEAHPV ESA
Length:663
Mass (Da):75,617
Last modified:July 10, 2007 - v2
Checksum:iEAE984696500ABD3
GO
Isoform 2 (identifier: Q96MT1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MMRNHRIASSLCGDQVFSKKKKKKKKNNM

Show »
Length:691
Mass (Da):78,905
Checksum:iB981A095846EB21D
GO
Isoform 3 (identifier: Q96MT1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAEVVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:680
Mass (Da):77,635
Checksum:iC1F1EC3ECDDD18CC
GO
Isoform 4 (identifier: Q96MT1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:677
Mass (Da):77,335
Checksum:i14F56CB45C03474E
GO
Isoform 5 (identifier: Q96MT1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MHRDRISPSNSPTWSLQVFSKKKKKKKKNNM

Note: No experimental confirmation available.

Show »
Length:693
Mass (Da):79,198
Checksum:iB31C1F06B683C778
GO

Sequence cautioni

The sequence AK308394 differs from that shown. Reason: Frameshift at position 189. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti9 – 91A → V in AAH42684. (PubMed:15489334)Curated
Sequence conflicti383 – 3831V → A in AAH42684. (PubMed:15489334)Curated
Sequence conflicti501 – 5011R → W in AK308394. (PubMed:14702039)Curated
Sequence conflicti657 – 6571A → V in AAH42684. (PubMed:15489334)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MMRNHRIASSLCGDQVFSKK KKKKKKNNM in isoform 2. 1 PublicationVSP_037501
Alternative sequencei1 – 11M → MAEVVFSKKKKKKKKNNM in isoform 3. 1 PublicationVSP_043661
Alternative sequencei1 – 11M → MVFSKKKKKKKKNNM in isoform 4. 1 PublicationVSP_043662
Alternative sequencei1 – 11M → MHRDRISPSNSPTWSLQVFS KKKKKKKKNNM in isoform 5. 1 PublicationVSP_044539

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056513 mRNA. Translation: BAB71200.1.
AK304228 mRNA. Translation: BAH14139.1.
AK304435 mRNA. Translation: BAH14185.1.
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1.
CCDSiCCDS4344.1. [Q96MT1-2]
CCDS56390.1. [Q96MT1-1]
CCDS56391.1. [Q96MT1-4]
CCDS56392.1. [Q96MT1-3]
CCDS56393.1. [Q96MT1-5]
RefSeqiNP_001186309.1. NM_001199380.1. [Q96MT1-5]
NP_001186310.1. NM_001199381.1. [Q96MT1-3]
NP_001186311.1. NM_001199382.1. [Q96MT1-4]
NP_001186312.1. NM_001199383.1. [Q96MT1-1]
NP_653327.1. NM_144726.2. [Q96MT1-2]
UniGeneiHs.349306.

Genome annotation databases

EnsembliENST00000274542; ENSP00000274542; ENSG00000145860. [Q96MT1-2]
ENST00000424310; ENSP00000409064; ENSG00000145860. [Q96MT1-1]
ENST00000518802; ENSP00000430955; ENSG00000145860. [Q96MT1-5]
ENST00000519865; ENSP00000430397; ENSG00000145860. [Q96MT1-1]
ENST00000520638; ENSP00000429071; ENSG00000145860. [Q96MT1-4]
ENST00000521606; ENSP00000430753; ENSG00000145860. [Q96MT1-3]
ENST00000611185; ENSP00000482720; ENSG00000145860. [Q96MT1-1]
GeneIDi153830.
KEGGihsa:153830.
UCSCiuc003lxo.2. human. [Q96MT1-2]
uc003lxp.3. human. [Q96MT1-1]
uc011ddy.2. human. [Q96MT1-4]
uc011ddz.2. human. [Q96MT1-3]

Polymorphism databases

DMDMi152060502.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056513 mRNA. Translation: BAB71200.1 .
AK304228 mRNA. Translation: BAH14139.1 .
AK304435 mRNA. Translation: BAH14185.1 .
AK308394 mRNA. No translation available.
AC134043 Genomic DNA. No translation available.
BC042684 mRNA. Translation: AAH42684.1 .
CCDSi CCDS4344.1. [Q96MT1-2 ]
CCDS56390.1. [Q96MT1-1 ]
CCDS56391.1. [Q96MT1-4 ]
CCDS56392.1. [Q96MT1-3 ]
CCDS56393.1. [Q96MT1-5 ]
RefSeqi NP_001186309.1. NM_001199380.1. [Q96MT1-5 ]
NP_001186310.1. NM_001199381.1. [Q96MT1-3 ]
NP_001186311.1. NM_001199382.1. [Q96MT1-4 ]
NP_001186312.1. NM_001199383.1. [Q96MT1-1 ]
NP_653327.1. NM_144726.2. [Q96MT1-2 ]
UniGenei Hs.349306.

3D structure databases

ProteinModelPortali Q96MT1.
SMRi Q96MT1. Positions 535-574.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127521. 2 interactions.
STRINGi 9606.ENSP00000274542.

PTM databases

PhosphoSitei Q96MT1.

Polymorphism databases

DMDMi 152060502.

Proteomic databases

MaxQBi Q96MT1.
PaxDbi Q96MT1.
PRIDEi Q96MT1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000274542 ; ENSP00000274542 ; ENSG00000145860 . [Q96MT1-2 ]
ENST00000424310 ; ENSP00000409064 ; ENSG00000145860 . [Q96MT1-1 ]
ENST00000518802 ; ENSP00000430955 ; ENSG00000145860 . [Q96MT1-5 ]
ENST00000519865 ; ENSP00000430397 ; ENSG00000145860 . [Q96MT1-1 ]
ENST00000520638 ; ENSP00000429071 ; ENSG00000145860 . [Q96MT1-4 ]
ENST00000521606 ; ENSP00000430753 ; ENSG00000145860 . [Q96MT1-3 ]
ENST00000611185 ; ENSP00000482720 ; ENSG00000145860 . [Q96MT1-1 ]
GeneIDi 153830.
KEGGi hsa:153830.
UCSCi uc003lxo.2. human. [Q96MT1-2 ]
uc003lxp.3. human. [Q96MT1-1 ]
uc011ddy.2. human. [Q96MT1-4 ]
uc011ddz.2. human. [Q96MT1-3 ]

Organism-specific databases

CTDi 153830.
GeneCardsi GC05M158517.
HGNCi HGNC:20853. RNF145.
HPAi HPA036562.
neXtProti NX_Q96MT1.
PharmGKBi PA134876286.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246550.
GeneTreei ENSGT00530000062938.
HOGENOMi HOG000072697.
HOVERGENi HBG054921.
InParanoidi Q96MT1.
OMAi GAEQNVM.
OrthoDBi EOG7C5M8S.
PhylomeDBi Q96MT1.
TreeFami TF318635.

Miscellaneous databases

ChiTaRSi RNF145. human.
GenomeRNAii 153830.
NextBioi 87196.
PROi Q96MT1.

Gene expression databases

Bgeei Q96MT1.
CleanExi HS_RNF145.
ExpressionAtlasi Q96MT1. baseline and differential.
Genevestigatori Q96MT1.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR025754. TRC8_N_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF13705. TRC8_N. 1 hit.
PF13639. zf-RING_2. 1 hit.
[Graphical view ]
SMARTi SM00184. RING. 1 hit.
[Graphical view ]
PROSITEi PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
    Tissue: Trachea.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.

Entry informationi

Entry nameiRN145_HUMAN
AccessioniPrimary (citable) accession number: Q96MT1
Secondary accession number(s): B7Z903
, B7Z949, E7EVI7, Q8IVP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 10, 2007
Last modified: November 26, 2014
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3