Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96MR7

- CA145_HUMAN

UniProt

Q96MR7 - CA145_HUMAN

Protein

Putative uncharacterized protein C1orf145

Gene

C1orf145

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Protein uncertaini
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 68 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative uncharacterized protein C1orf145
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:32047. C1orf145.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 158158Putative uncharacterized protein C1orf145PRO_0000282581Add
    BLAST

    Proteomic databases

    PaxDbiQ96MR7.
    PRIDEiQ96MR7.

    Expressioni

    Gene expression databases

    BgeeiQ96MR7.
    CleanExiHS_C1orf145.
    GenevestigatoriQ96MR7.

    Organism-specific databases

    HPAiHPA046612.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96MR7.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG72914.
    HOGENOMiHOG000111255.
    InParanoidiQ96MR7.
    OMAiSARREDC.
    OrthoDBiEOG793B9G.
    PhylomeDBiQ96MR7.
    TreeFamiTF342158.

    Family and domain databases

    InterProiIPR029408. DUF4608.
    [Graphical view]
    PfamiPF15381. DUF4608. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96MR7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYTASSSAET LRTVRRRSVP SSSMPYLALA HNRVSSLNHA ASVDGWGTSH    50
    RNVADSFSRT SRSCSRFLKG TAGSARREDW NGHLQPWIPR PDRRGWETAD 100
    RKGERTQVHG LRRSLGPRAP HPGAHRALRP AQSCRSGPRG WTPCRCRGRG 150
    PTACRRGS 158

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Length:158
    Mass (Da):17,524
    Last modified:December 1, 2001 - v1
    Checksum:i9E9CAA76CC89CB76
    GO
    Isoform 2 (identifier: Q96MR7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-113: WNGHLQPWIPRPDRRGWETADRKGERTQVHGLRR → CYFEAYMGSWFLDPRIYQNLCILKFYGQPCGTQA
         114-158: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:113
    Mass (Da):12,614
    Checksum:i4E05291B28F79744
    GO

    Sequence cautioni

    The sequence CAI15073.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei80 – 11334WNGHL…HGLRR → CYFEAYMGSWFLDPRIYQNL CILKFYGQPCGTQA in isoform 2. 1 PublicationVSP_024211Add
    BLAST
    Alternative sequencei114 – 15845Missing in isoform 2. 1 PublicationVSP_024212Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056556 mRNA. Translation: BAB71215.1.
    AL359510 Genomic DNA. Translation: CAI15073.1. Different initiation.
    BC027909 mRNA. No translation available.
    UniGeneiHs.650039.

    Genome annotation databases

    EnsembliENST00000295012; ENSP00000295012; ENSG00000162913. [Q96MR7-2]
    ENST00000337335; ENSP00000338823; ENSG00000162913. [Q96MR7-1]
    UCSCiuc031psn.1. human. [Q96MR7-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056556 mRNA. Translation: BAB71215.1 .
    AL359510 Genomic DNA. Translation: CAI15073.1 . Different initiation.
    BC027909 mRNA. No translation available.
    UniGenei Hs.650039.

    3D structure databases

    ProteinModelPortali Q96MR7.
    ModBasei Search...
    MobiDBi Search...

    Proteomic databases

    PaxDbi Q96MR7.
    PRIDEi Q96MR7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000295012 ; ENSP00000295012 ; ENSG00000162913 . [Q96MR7-2 ]
    ENST00000337335 ; ENSP00000338823 ; ENSG00000162913 . [Q96MR7-1 ]
    UCSCi uc031psn.1. human. [Q96MR7-2 ]

    Organism-specific databases

    GeneCardsi GC01M228391.
    HGNCi HGNC:32047. C1orf145.
    HPAi HPA046612.
    neXtProti NX_Q96MR7.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72914.
    HOGENOMi HOG000111255.
    InParanoidi Q96MR7.
    OMAi SARREDC.
    OrthoDBi EOG793B9G.
    PhylomeDBi Q96MR7.
    TreeFami TF342158.

    Gene expression databases

    Bgeei Q96MR7.
    CleanExi HS_C1orf145.
    Genevestigatori Q96MR7.

    Family and domain databases

    InterProi IPR029408. DUF4608.
    [Graphical view ]
    Pfami PF15381. DUF4608. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Teratocarcinoma.
    2. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-158 (ISOFORM 2).
      Tissue: Lung.

    Entry informationi

    Entry nameiCA145_HUMAN
    AccessioniPrimary (citable) accession number: Q96MR7
    Secondary accession number(s): Q5T438, Q8N372
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 68 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM

    External Data

    Dasty 3