Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MR7

- CA145_HUMAN

UniProt

Q96MR7 - CA145_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative uncharacterized protein C1orf145

Gene

C1orf145

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Protein uncertaini

Names & Taxonomyi

Protein namesi
Recommended name:
Putative uncharacterized protein C1orf145
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:32047. C1orf145.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 158158Putative uncharacterized protein C1orf145PRO_0000282581Add
BLAST

Proteomic databases

PaxDbiQ96MR7.
PRIDEiQ96MR7.

Expressioni

Gene expression databases

BgeeiQ96MR7.
CleanExiHS_C1orf145.
GenevestigatoriQ96MR7.

Organism-specific databases

HPAiHPA046612.

Structurei

3D structure databases

ProteinModelPortaliQ96MR7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiNOG72914.
GeneTreeiENSGT00390000016274.
HOGENOMiHOG000111255.
InParanoidiQ96MR7.
OMAiSARREDC.
OrthoDBiEOG793B9G.
PhylomeDBiQ96MR7.
TreeFamiTF342158.

Family and domain databases

InterProiIPR029408. DUF4608.
[Graphical view]
PfamiPF15381. DUF4608. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96MR7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYTASSSAET LRTVRRRSVP SSSMPYLALA HNRVSSLNHA ASVDGWGTSH
60 70 80 90 100
RNVADSFSRT SRSCSRFLKG TAGSARREDW NGHLQPWIPR PDRRGWETAD
110 120 130 140 150
RKGERTQVHG LRRSLGPRAP HPGAHRALRP AQSCRSGPRG WTPCRCRGRG

PTACRRGS

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Length:158
Mass (Da):17,524
Last modified:December 1, 2001 - v1
Checksum:i9E9CAA76CC89CB76
GO
Isoform 2 (identifier: Q96MR7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-113: WNGHLQPWIPRPDRRGWETADRKGERTQVHGLRR → CYFEAYMGSWFLDPRIYQNLCILKFYGQPCGTQA
     114-158: Missing.

Note: No experimental confirmation available.

Show »
Length:113
Mass (Da):12,614
Checksum:i4E05291B28F79744
GO

Sequence cautioni

The sequence CAI15073.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei80 – 11334WNGHL…HGLRR → CYFEAYMGSWFLDPRIYQNL CILKFYGQPCGTQA in isoform 2. 1 PublicationVSP_024211Add
BLAST
Alternative sequencei114 – 15845Missing in isoform 2. 1 PublicationVSP_024212Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056556 mRNA. Translation: BAB71215.1.
AL359510 Genomic DNA. Translation: CAI15073.1. Different initiation.
BC027909 mRNA. No translation available.
UniGeneiHs.650039.

Genome annotation databases

EnsembliENST00000295012; ENSP00000295012; ENSG00000162913. [Q96MR7-2]
ENST00000337335; ENSP00000338823; ENSG00000162913. [Q96MR7-1]
UCSCiuc031psn.1. human. [Q96MR7-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056556 mRNA. Translation: BAB71215.1 .
AL359510 Genomic DNA. Translation: CAI15073.1 . Different initiation.
BC027909 mRNA. No translation available.
UniGenei Hs.650039.

3D structure databases

ProteinModelPortali Q96MR7.
ModBasei Search...
MobiDBi Search...

Proteomic databases

PaxDbi Q96MR7.
PRIDEi Q96MR7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295012 ; ENSP00000295012 ; ENSG00000162913 . [Q96MR7-2 ]
ENST00000337335 ; ENSP00000338823 ; ENSG00000162913 . [Q96MR7-1 ]
UCSCi uc031psn.1. human. [Q96MR7-2 ]

Organism-specific databases

GeneCardsi GC01M228391.
HGNCi HGNC:32047. C1orf145.
HPAi HPA046612.
neXtProti NX_Q96MR7.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72914.
GeneTreei ENSGT00390000016274.
HOGENOMi HOG000111255.
InParanoidi Q96MR7.
OMAi SARREDC.
OrthoDBi EOG793B9G.
PhylomeDBi Q96MR7.
TreeFami TF342158.

Gene expression databases

Bgeei Q96MR7.
CleanExi HS_C1orf145.
Genevestigatori Q96MR7.

Family and domain databases

InterProi IPR029408. DUF4608.
[Graphical view ]
Pfami PF15381. DUF4608. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Teratocarcinoma.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 3-158 (ISOFORM 2).
    Tissue: Lung.

Entry informationi

Entry nameiCA145_HUMAN
AccessioniPrimary (citable) accession number: Q96MR7
Secondary accession number(s): Q5T438, Q8N372
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 69 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM

External Data

Dasty 3