Q96MM7 (H6ST2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Heparan-sulfate 6-O-sulfotransferase 2 Short name=HS6ST-2 EC=2.8.2.- | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 605 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | 6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate. |
| Catalytic activity | 3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate. |
| Subcellular location | Membrane; Single-pass type II membrane protein Potential. |
| Sequence similarities | Belongs to the sulfotransferase 6 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Transferase |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | carbohydrate metabolic process Traceable author statement. Source: Reactome glycosaminoglycan biosynthetic processTraceable author statement. Source: Reactome small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | Golgi membrane Traceable author statement. Source: Reactome integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | sulfotransferase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MM7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96MM7-2) Also known as: HS6ST-2S; The sequence of this isoform differs from the canonical sequence as follows: 1-146: Missing. | ||||||
| Isoform 3 (identifier: Q96MM7-3) Also known as: HS6ST-2; The sequence of this isoform differs from the canonical sequence as follows: 1-146: Missing. 315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 605 | 605 | Heparan-sulfate 6-O-sulfotransferase 2 | PRO_0000190805 | |||||
Regions | |||||||||
| Topological domain | 1 – 4 | 4 | Cytoplasmic Potential | ||||||
| Transmembrane | 5 – 27 | 23 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 28 – 605 | 578 | Lumenal Potential | ||||||
| Region | 236 – 242 | 7 | 5'-phosphosulfate-binding Potential | ||||||
| Region | 325 – 333 | 9 | 3'-phosphate binding Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 209 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 404 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 460 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 544 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 556 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 564 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 589 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 592 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 146 | 146 | Missing in isoform 2 and isoform 3. | VSP_015846 | |||||
| Alternative sequence | 315 – 316 | 2 | SR → SRWRIFQILDAASKDKRGSP NTNAGANSPSSTKTRNTSKS GK in isoform 3. | VSP_015847 | |||||
| Natural variant | 127 | 1 | K → N. Corresponds to variant rs7053397 [ dbSNP | Ensembl ]. | VAR_061828 | |||||
Experimental info | |||||||||
| Sequence conflict | 192 | 1 | D → G in BAB71260. Ref.2 | ||||||
| Sequence conflict | 299 | 1 | C → Y in AAH37325. Ref.4 | ||||||
| Sequence conflict | 426 | 1 | K → R in BAC11597. Ref.5 | ||||||
| Sequence conflict | 568 | 1 | S → N in BAB71260. Ref.2 | ||||||
| Sequence conflict | 580 | 1 | Q → R in BAC11597. Ref.5 | ||||||
| Sequence conflict | 585 | 1 | E → G in BAC11597. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Biosynthesis of heparan sulphate with diverse structures and functions: two alternatively spliced forms of human heparan sulphate 6-O-sulphotransferase-2 having different expression patterns and properties." Habuchi H., Miyake G., Nogami K., Kuroiwa A., Matsuda Y., Kusche-Gullberg M., Habuchi O., Tanaka M., Kimata K. Biochem. J. 371:131-142(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta. |
| [3] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 176-605 (ISOFORM 3). Tissue: Placenta. |
| [5] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 136-605. Tissue: Teratocarcinoma. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-605. Tissue: Amygdala. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB067776 mRNA. Translation: BAC07183.1. AB067777 mRNA. Translation: BAC07184.1. AK027720 mRNA. Translation: BAB55322.1. AK056706 mRNA. Translation: BAB71260.1. Z81365, Z86064 Genomic DNA. Translation: CAX30811.1. Z81365, Z86064 Genomic DNA. Translation: CAX30812.1. AL022309 Genomic DNA. No translation available. AL022159 Genomic DNA. No translation available. Z82205 Genomic DNA. No translation available. Z86064, Z81365 Genomic DNA. Translation: CAI42774.1. Z86064, Z81365 Genomic DNA. Translation: CAI42775.1. BC037325 mRNA. Translation: AAH37325.1. BC094718 mRNA. Translation: AAH94718.1. BC110620 mRNA. Translation: AAI10621.1. BC110621 mRNA. Translation: AAI10622.1. AK075402 mRNA. Translation: BAC11597.1. AL831923 mRNA. Translation: CAD38583.1. |
| IPI | IPI00157454. IPI00160316. IPI00937318. |
| RefSeq | NP_001070656.1. NM_001077188.1. NP_671704.3. NM_147175.3. |
| UniGene | Hs.385956. |
3D structure databases | |
| ProteinModelPortal | Q96MM7. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q96MM7. |
Polymorphism databases | |
| DMDM | 77416506. |
Proteomic databases | |
| PaxDb | Q96MM7. |
| PRIDE | Q96MM7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000370836; ENSP00000359873; ENSG00000171004. ENST00000370837; ENSP00000359874; ENSG00000171004. ENST00000461959; ENSP00000435108; ENSG00000171004. |
| GeneID | 90161. |
| KEGG | hsa:90161. |
| UCSC | uc011mvb.1. human. uc011mvc.1. human. |
Organism-specific databases | |
| CTD | 90161. |
| GeneCards | GC0XM131760. |
| HGNC | HGNC:19133. HS6ST2. |
| HPA | HPA034625. |
| MIM | 300545. gene. |
| neXtProt | NX_Q96MM7. |
| PharmGKB | PA134950831. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG302961. |
| HOVERGEN | HBG083012. |
| KO | K08102. |
| OrthoDB | EOG4X6C8G. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_116125. Disease. |
Gene expression databases | |
| ArrayExpress | Q96MM7. |
| Bgee | Q96MM7. |
| CleanEx | HS_HS6ST2. |
| Genevestigator | Q96MM7. |
| GermOnline | ENSG00000171004. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR010635. Heparan_SO4-6-sulfoTrfase. IPR005331. Sulfotransferase. [Graphical view] |
| PANTHER | PTHR12812. PTHR12812. 1 hit. |
| Pfam | PF03567. Sulfotransfer_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | HS6ST2. human. |
| GenomeRNAi | 90161. |
| NextBio | 76561. |
| SOURCE | Search... |
Entry information
| Entry name | H6ST2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MM7 Secondary accession number(s): B9WRT4 Q96SJ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
