Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96MM7

- H6ST2_HUMAN

UniProt

Q96MM7 - H6ST2_HUMAN

Protein

Heparan-sulfate 6-O-sulfotransferase 2

Gene

HS6ST2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 2 (11 Oct 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

    Catalytic activityi

    3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

    GO - Molecular functioni

    1. sulfotransferase activity Source: InterPro

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. glycosaminoglycan biosynthetic process Source: Reactome
    3. glycosaminoglycan metabolic process Source: Reactome
    4. small molecule metabolic process Source: Reactome

    Keywords - Molecular functioni

    Transferase

    Enzyme and pathway databases

    ReactomeiREACT_121248. HS-GAG biosynthesis.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
    Short name:
    HS6ST-2
    Gene namesi
    Name:HS6ST2
    ORF Names:PSEC0092
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:19133. HS6ST2.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. Golgi membrane Source: Reactome
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134950831.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 605605Heparan-sulfate 6-O-sulfotransferase 2PRO_0000190805Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi209 – 2091N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi404 – 4041N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi460 – 4601N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi544 – 5441N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi556 – 5561N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi564 – 5641N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi589 – 5891N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi592 – 5921N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ96MM7.
    PaxDbiQ96MM7.
    PRIDEiQ96MM7.

    PTM databases

    PhosphoSiteiQ96MM7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96MM7.
    BgeeiQ96MM7.
    CleanExiHS_HS6ST2.
    GenevestigatoriQ96MM7.

    Organism-specific databases

    HPAiHPA034625.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96MM7.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 44CytoplasmicSequence Analysis
    Topological domaini28 – 605578LumenalSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei5 – 2723Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni236 – 24275'-phosphosulfate-bindingSequence Analysis
    Regioni325 – 33393'-phosphate bindingSequence Analysis

    Sequence similaritiesi

    Belongs to the sulfotransferase 6 family.Curated

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG302961.
    HOVERGENiHBG083012.
    KOiK08102.
    OMAiLRPSRWR.
    OrthoDBiEOG75MVW3.
    PhylomeDBiQ96MM7.
    TreeFamiTF312835.

    Family and domain databases

    InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view]
    PANTHERiPTHR12812. PTHR12812. 1 hit.
    PfamiPF03567. Sulfotransfer_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96MM7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALPACAVRE FEPPRQPERG APVRTTCPRR HSRVEAELAA SRPGSVAASV    50
    RAGPPRGVSH GFHTRPLLDK PRKASSSLAG AACAPLFALL SRGRRRRMHV 100
    LRRRWDLGSL CRALLTRGLA ALGHSLKHVL GAIFSKIFGP MASVGNMDEK 150
    SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES 200
    SARFVPRYNF TRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI 250
    QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV 300
    PSVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV 350
    CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV 400
    GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM 450
    NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ 500
    FMRQKEHQEA RRKRQEQRKF LKGRLLQTHF QSQGQGQSQN PNQNQSQNPN 550
    PNANQNLTQN LMQNLTQSLS QKENRESPKQ NSGKEQNDNT SNGTNDYIGS 600
    VEKWR 605
    Length:605
    Mass (Da):69,130
    Last modified:October 11, 2005 - v2
    Checksum:i10528AC424935B13
    GO
    Isoform 2 (identifier: Q96MM7-2) [UniParc]FASTAAdd to Basket

    Also known as: HS6ST-2S

    The sequence of this isoform differs from the canonical sequence as follows:
         1-146: Missing.

    Show »
    Length:459
    Mass (Da):53,436
    Checksum:i74B35C8D212BA566
    GO
    Isoform 3 (identifier: Q96MM7-3) [UniParc]FASTAAdd to Basket

    Also known as: HS6ST-2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-146: Missing.
         315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

    Note: No experimental confirmation available.

    Show »
    Length:499
    Mass (Da):57,697
    Checksum:iFE81141A7FF0B9E7
    GO
    Isoform 4 (identifier: Q96MM7-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

    Note: Gene prediction based on EST data.

    Show »
    Length:645
    Mass (Da):73,391
    Checksum:iBC025604FDC3669E
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti192 – 1921D → G in BAB71260. (PubMed:14702039)Curated
    Sequence conflicti299 – 2991C → Y in AAH37325. (PubMed:15489334)Curated
    Sequence conflicti426 – 4261K → R in BAC11597. (PubMed:16303743)Curated
    Sequence conflicti568 – 5681S → N in BAB71260. (PubMed:14702039)Curated
    Sequence conflicti580 – 5801Q → R in BAC11597. (PubMed:16303743)Curated
    Sequence conflicti585 – 5851E → G in BAC11597. (PubMed:16303743)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti127 – 1271K → N.
    Corresponds to variant rs7053397 [ dbSNP | Ensembl ].
    VAR_061828

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 146146Missing in isoform 2 and isoform 3. 3 PublicationsVSP_015846Add
    BLAST
    Alternative sequencei315 – 3162SR → SRWRIFQILDAASKDKRGSP NTNAGANSPSSTKTRNTSKS GK in isoform 3 and isoform 4. 2 PublicationsVSP_015847

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067776 mRNA. Translation: BAC07183.1.
    AB067777 mRNA. Translation: BAC07184.1.
    AK027720 mRNA. Translation: BAB55322.1.
    AK056706 mRNA. Translation: BAB71260.1.
    Z81365, Z86064 Genomic DNA. Translation: CAX30811.1.
    Z81365, Z86064 Genomic DNA. Translation: CAX30812.1.
    AL022309 Genomic DNA. No translation available.
    AL022159 Genomic DNA. No translation available.
    Z82205 Genomic DNA. No translation available.
    Z86064, Z81365 Genomic DNA. Translation: CAI42774.1.
    Z86064, Z81365 Genomic DNA. Translation: CAI42775.1.
    BC037325 mRNA. Translation: AAH37325.1.
    BC094718 mRNA. Translation: AAH94718.1.
    BC110620 mRNA. Translation: AAI10621.1.
    BC110621 mRNA. Translation: AAI10622.1.
    AK075402 mRNA. Translation: BAC11597.1.
    AL831923 mRNA. Translation: CAD38583.1.
    CCDSiCCDS48169.1. [Q96MM7-1]
    CCDS48170.1. [Q96MM7-4]
    RefSeqiNP_001070656.1. NM_001077188.1. [Q96MM7-4]
    NP_671704.3. NM_147175.3. [Q96MM7-1]
    XP_005262547.1. XM_005262490.2. [Q96MM7-4]
    XP_006724853.1. XM_006724790.1. [Q96MM7-1]
    UniGeneiHs.385956.

    Genome annotation databases

    EnsembliENST00000370836; ENSP00000359873; ENSG00000171004. [Q96MM7-1]
    ENST00000521489; ENSP00000429473; ENSG00000171004. [Q96MM7-4]
    GeneIDi90161.
    KEGGihsa:90161.
    UCSCiuc011mvb.1. human. [Q96MM7-3]
    uc011mvc.1. human. [Q96MM7-1]

    Polymorphism databases

    DMDMi77416506.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB067776 mRNA. Translation: BAC07183.1 .
    AB067777 mRNA. Translation: BAC07184.1 .
    AK027720 mRNA. Translation: BAB55322.1 .
    AK056706 mRNA. Translation: BAB71260.1 .
    Z81365 , Z86064 Genomic DNA. Translation: CAX30811.1 .
    Z81365 , Z86064 Genomic DNA. Translation: CAX30812.1 .
    AL022309 Genomic DNA. No translation available.
    AL022159 Genomic DNA. No translation available.
    Z82205 Genomic DNA. No translation available.
    Z86064 , Z81365 Genomic DNA. Translation: CAI42774.1 .
    Z86064 , Z81365 Genomic DNA. Translation: CAI42775.1 .
    BC037325 mRNA. Translation: AAH37325.1 .
    BC094718 mRNA. Translation: AAH94718.1 .
    BC110620 mRNA. Translation: AAI10621.1 .
    BC110621 mRNA. Translation: AAI10622.1 .
    AK075402 mRNA. Translation: BAC11597.1 .
    AL831923 mRNA. Translation: CAD38583.1 .
    CCDSi CCDS48169.1. [Q96MM7-1 ]
    CCDS48170.1. [Q96MM7-4 ]
    RefSeqi NP_001070656.1. NM_001077188.1. [Q96MM7-4 ]
    NP_671704.3. NM_147175.3. [Q96MM7-1 ]
    XP_005262547.1. XM_005262490.2. [Q96MM7-4 ]
    XP_006724853.1. XM_006724790.1. [Q96MM7-1 ]
    UniGenei Hs.385956.

    3D structure databases

    ProteinModelPortali Q96MM7.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q96MM7.

    Polymorphism databases

    DMDMi 77416506.

    Proteomic databases

    MaxQBi Q96MM7.
    PaxDbi Q96MM7.
    PRIDEi Q96MM7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000370836 ; ENSP00000359873 ; ENSG00000171004 . [Q96MM7-1 ]
    ENST00000521489 ; ENSP00000429473 ; ENSG00000171004 . [Q96MM7-4 ]
    GeneIDi 90161.
    KEGGi hsa:90161.
    UCSCi uc011mvb.1. human. [Q96MM7-3 ]
    uc011mvc.1. human. [Q96MM7-1 ]

    Organism-specific databases

    CTDi 90161.
    GeneCardsi GC0XM131760.
    HGNCi HGNC:19133. HS6ST2.
    HPAi HPA034625.
    MIMi 300545. gene.
    neXtProti NX_Q96MM7.
    PharmGKBi PA134950831.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG302961.
    HOVERGENi HBG083012.
    KOi K08102.
    OMAi LRPSRWR.
    OrthoDBi EOG75MVW3.
    PhylomeDBi Q96MM7.
    TreeFami TF312835.

    Enzyme and pathway databases

    Reactomei REACT_121248. HS-GAG biosynthesis.

    Miscellaneous databases

    ChiTaRSi HS6ST2. human.
    GenomeRNAii 90161.
    NextBioi 76561.
    PROi Q96MM7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96MM7.
    Bgeei Q96MM7.
    CleanExi HS_HS6ST2.
    Genevestigatori Q96MM7.

    Family and domain databases

    InterProi IPR010635. Heparan_SO4-6-sulfoTrfase.
    IPR027417. P-loop_NTPase.
    IPR005331. Sulfotransferase.
    [Graphical view ]
    PANTHERi PTHR12812. PTHR12812. 1 hit.
    Pfami PF03567. Sulfotransfer_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Biosynthesis of heparan sulphate with diverse structures and functions: two alternatively spliced forms of human heparan sulphate 6-O-sulphotransferase-2 having different expression patterns and properties."
      Habuchi H., Miyake G., Nogami K., Kuroiwa A., Matsuda Y., Kusche-Gullberg M., Habuchi O., Tanaka M., Kimata K.
      Biochem. J. 371:131-142(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Placenta.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 176-605 (ISOFORM 3).
      Tissue: Placenta.
    5. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 136-605.
      Tissue: Teratocarcinoma.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-605.
      Tissue: Amygdala.

    Entry informationi

    Entry nameiH6ST2_HUMAN
    AccessioniPrimary (citable) accession number: Q96MM7
    Secondary accession number(s): B9WRT4
    , B9WRT5, E9PDY5, Q2TB13, Q4VC07, Q6PIC4, Q86SM9, Q8N3T4, Q8NBN4, Q96SJ4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 11, 2005
    Last sequence update: October 11, 2005
    Last modified: October 1, 2014
    This is version 93 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3