SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MM7

- H6ST2_HUMAN

UniProt

Q96MM7 - H6ST2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Heparan-sulfate 6-O-sulfotransferase 2
Gene
HS6ST2, PSEC0092
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Catalytic activityi

3'-phosphoadenylyl sulfate + [heparan sulfate]-glucosamine = adenosine 3',5'-bisphosphate + [heparan sulfate]-glucosamine 6-sulfate.

GO - Molecular functioni

  1. sulfotransferase activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. glycosaminoglycan biosynthetic process Source: Reactome
  3. glycosaminoglycan metabolic process Source: Reactome
  4. small molecule metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Enzyme and pathway databases

ReactomeiREACT_121248. HS-GAG biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Heparan-sulfate 6-O-sulfotransferase 2 (EC:2.8.2.-)
Short name:
HS6ST-2
Gene namesi
Name:HS6ST2
ORF Names:PSEC0092
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:19133. HS6ST2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 44Cytoplasmic Reviewed prediction
Transmembranei5 – 2723Helical; Signal-anchor for type II membrane protein; Reviewed prediction
Add
BLAST
Topological domaini28 – 605578Lumenal Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. Golgi membrane Source: Reactome
  2. extracellular vesicular exosome Source: UniProt
  3. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134950831.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 605605Heparan-sulfate 6-O-sulfotransferase 2
PRO_0000190805Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi209 – 2091N-linked (GlcNAc...) Reviewed prediction
Glycosylationi404 – 4041N-linked (GlcNAc...) Reviewed prediction
Glycosylationi460 – 4601N-linked (GlcNAc...) Reviewed prediction
Glycosylationi544 – 5441N-linked (GlcNAc...) Reviewed prediction
Glycosylationi556 – 5561N-linked (GlcNAc...) Reviewed prediction
Glycosylationi564 – 5641N-linked (GlcNAc...) Reviewed prediction
Glycosylationi589 – 5891N-linked (GlcNAc...) Reviewed prediction
Glycosylationi592 – 5921N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ96MM7.
PaxDbiQ96MM7.
PRIDEiQ96MM7.

PTM databases

PhosphoSiteiQ96MM7.

Expressioni

Gene expression databases

ArrayExpressiQ96MM7.
BgeeiQ96MM7.
CleanExiHS_HS6ST2.
GenevestigatoriQ96MM7.

Organism-specific databases

HPAiHPA034625.

Structurei

3D structure databases

ProteinModelPortaliQ96MM7.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni236 – 24275'-phosphosulfate-binding Reviewed prediction
Regioni325 – 33393'-phosphate binding Reviewed prediction

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG302961.
HOVERGENiHBG083012.
KOiK08102.
OMAiLRPSRWR.
OrthoDBiEOG75MVW3.
PhylomeDBiQ96MM7.
TreeFamiTF312835.

Family and domain databases

InterProiIPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12812. PTHR12812. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96MM7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALPACAVRE FEPPRQPERG APVRTTCPRR HSRVEAELAA SRPGSVAASV    50
RAGPPRGVSH GFHTRPLLDK PRKASSSLAG AACAPLFALL SRGRRRRMHV 100
LRRRWDLGSL CRALLTRGLA ALGHSLKHVL GAIFSKIFGP MASVGNMDEK 150
SNKLLLALVM LFLFAVIVLQ YVCPGTECQL LRLQAFSSPV PDPYRSEDES 200
SARFVPRYNF TRGDLLRKVD FDIKGDDLIV FLHIQKTGGT TFGRHLVRNI 250
QLEQPCECRV GQKKCTCHRP GKRETWLFSR FSTGWSCGLH ADWTELTSCV 300
PSVVDGKRDA RLRPSRNFHY ITILRDPVSR YLSEWRHVQR GATWKASLHV 350
CDGRPPTSEE LPSCYTGDDW SGCPLKEFMD CPYNLANNRQ VRMLSDLTLV 400
GCYNLSVMPE KQRNKVLLES AKSNLKHMAF FGLTEFQRKT QYLFEKTFNM 450
NFISPFTQYN TTRASSVEIN EEIQKRIEGL NFLDMELYSY AKDLFLQRYQ 500
FMRQKEHQEA RRKRQEQRKF LKGRLLQTHF QSQGQGQSQN PNQNQSQNPN 550
PNANQNLTQN LMQNLTQSLS QKENRESPKQ NSGKEQNDNT SNGTNDYIGS 600
VEKWR 605
Length:605
Mass (Da):69,130
Last modified:October 11, 2005 - v2
Checksum:i10528AC424935B13
GO
Isoform 2 (identifier: Q96MM7-2) [UniParc]FASTAAdd to Basket

Also known as: HS6ST-2S

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:459
Mass (Da):53,436
Checksum:i74B35C8D212BA566
GO
Isoform 3 (identifier: Q96MM7-3) [UniParc]FASTAAdd to Basket

Also known as: HS6ST-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Note: No experimental confirmation available.

Show »
Length:499
Mass (Da):57,697
Checksum:iFE81141A7FF0B9E7
GO
Isoform 4 (identifier: Q96MM7-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     315-316: SR → SRWRIFQILDAASKDKRGSPNTNAGANSPSSTKTRNTSKSGK

Note: Gene prediction based on EST data.

Show »
Length:645
Mass (Da):73,391
Checksum:iBC025604FDC3669E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti127 – 1271K → N.
Corresponds to variant rs7053397 [ dbSNP | Ensembl ].
VAR_061828

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 146146Missing in isoform 2 and isoform 3.
VSP_015846Add
BLAST
Alternative sequencei315 – 3162SR → SRWRIFQILDAASKDKRGSP NTNAGANSPSSTKTRNTSKS GK in isoform 3 and isoform 4.
VSP_015847

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti192 – 1921D → G in BAB71260. 1 Publication
Sequence conflicti299 – 2991C → Y in AAH37325. 1 Publication
Sequence conflicti426 – 4261K → R in BAC11597. 1 Publication
Sequence conflicti568 – 5681S → N in BAB71260. 1 Publication
Sequence conflicti580 – 5801Q → R in BAC11597. 1 Publication
Sequence conflicti585 – 5851E → G in BAC11597. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067776 mRNA. Translation: BAC07183.1.
AB067777 mRNA. Translation: BAC07184.1.
AK027720 mRNA. Translation: BAB55322.1.
AK056706 mRNA. Translation: BAB71260.1.
Z81365, Z86064 Genomic DNA. Translation: CAX30811.1.
Z81365, Z86064 Genomic DNA. Translation: CAX30812.1.
AL022309 Genomic DNA. No translation available.
AL022159 Genomic DNA. No translation available.
Z82205 Genomic DNA. No translation available.
Z86064, Z81365 Genomic DNA. Translation: CAI42774.1.
Z86064, Z81365 Genomic DNA. Translation: CAI42775.1.
BC037325 mRNA. Translation: AAH37325.1.
BC094718 mRNA. Translation: AAH94718.1.
BC110620 mRNA. Translation: AAI10621.1.
BC110621 mRNA. Translation: AAI10622.1.
AK075402 mRNA. Translation: BAC11597.1.
AL831923 mRNA. Translation: CAD38583.1.
CCDSiCCDS48169.1. [Q96MM7-1]
CCDS48170.1. [Q96MM7-4]
RefSeqiNP_001070656.1. NM_001077188.1. [Q96MM7-4]
NP_671704.3. NM_147175.3. [Q96MM7-1]
XP_005262547.1. XM_005262490.2. [Q96MM7-4]
XP_006724853.1. XM_006724790.1. [Q96MM7-1]
UniGeneiHs.385956.

Genome annotation databases

EnsembliENST00000370836; ENSP00000359873; ENSG00000171004. [Q96MM7-1]
ENST00000521489; ENSP00000429473; ENSG00000171004. [Q96MM7-4]
GeneIDi90161.
KEGGihsa:90161.
UCSCiuc011mvb.1. human. [Q96MM7-3]
uc011mvc.1. human. [Q96MM7-1]

Polymorphism databases

DMDMi77416506.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB067776 mRNA. Translation: BAC07183.1 .
AB067777 mRNA. Translation: BAC07184.1 .
AK027720 mRNA. Translation: BAB55322.1 .
AK056706 mRNA. Translation: BAB71260.1 .
Z81365 , Z86064 Genomic DNA. Translation: CAX30811.1 .
Z81365 , Z86064 Genomic DNA. Translation: CAX30812.1 .
AL022309 Genomic DNA. No translation available.
AL022159 Genomic DNA. No translation available.
Z82205 Genomic DNA. No translation available.
Z86064 , Z81365 Genomic DNA. Translation: CAI42774.1 .
Z86064 , Z81365 Genomic DNA. Translation: CAI42775.1 .
BC037325 mRNA. Translation: AAH37325.1 .
BC094718 mRNA. Translation: AAH94718.1 .
BC110620 mRNA. Translation: AAI10621.1 .
BC110621 mRNA. Translation: AAI10622.1 .
AK075402 mRNA. Translation: BAC11597.1 .
AL831923 mRNA. Translation: CAD38583.1 .
CCDSi CCDS48169.1. [Q96MM7-1 ]
CCDS48170.1. [Q96MM7-4 ]
RefSeqi NP_001070656.1. NM_001077188.1. [Q96MM7-4 ]
NP_671704.3. NM_147175.3. [Q96MM7-1 ]
XP_005262547.1. XM_005262490.2. [Q96MM7-4 ]
XP_006724853.1. XM_006724790.1. [Q96MM7-1 ]
UniGenei Hs.385956.

3D structure databases

ProteinModelPortali Q96MM7.
ModBasei Search...

PTM databases

PhosphoSitei Q96MM7.

Polymorphism databases

DMDMi 77416506.

Proteomic databases

MaxQBi Q96MM7.
PaxDbi Q96MM7.
PRIDEi Q96MM7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000370836 ; ENSP00000359873 ; ENSG00000171004 . [Q96MM7-1 ]
ENST00000521489 ; ENSP00000429473 ; ENSG00000171004 . [Q96MM7-4 ]
GeneIDi 90161.
KEGGi hsa:90161.
UCSCi uc011mvb.1. human. [Q96MM7-3 ]
uc011mvc.1. human. [Q96MM7-1 ]

Organism-specific databases

CTDi 90161.
GeneCardsi GC0XM131760.
HGNCi HGNC:19133. HS6ST2.
HPAi HPA034625.
MIMi 300545. gene.
neXtProti NX_Q96MM7.
PharmGKBi PA134950831.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG302961.
HOVERGENi HBG083012.
KOi K08102.
OMAi LRPSRWR.
OrthoDBi EOG75MVW3.
PhylomeDBi Q96MM7.
TreeFami TF312835.

Enzyme and pathway databases

Reactomei REACT_121248. HS-GAG biosynthesis.

Miscellaneous databases

ChiTaRSi HS6ST2. human.
GenomeRNAii 90161.
NextBioi 76561.
PROi Q96MM7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96MM7.
Bgeei Q96MM7.
CleanExi HS_HS6ST2.
Genevestigatori Q96MM7.

Family and domain databases

InterProi IPR010635. Heparan_SO4-6-sulfoTrfase.
IPR027417. P-loop_NTPase.
IPR005331. Sulfotransferase.
[Graphical view ]
PANTHERi PTHR12812. PTHR12812. 1 hit.
Pfami PF03567. Sulfotransfer_2. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Biosynthesis of heparan sulphate with diverse structures and functions: two alternatively spliced forms of human heparan sulphate 6-O-sulphotransferase-2 having different expression patterns and properties."
    Habuchi H., Miyake G., Nogami K., Kuroiwa A., Matsuda Y., Kusche-Gullberg M., Habuchi O., Tanaka M., Kimata K.
    Biochem. J. 371:131-142(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 176-605 (ISOFORM 3).
    Tissue: Placenta.
  5. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 136-605.
    Tissue: Teratocarcinoma.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 465-605.
    Tissue: Amygdala.

Entry informationi

Entry nameiH6ST2_HUMAN
AccessioniPrimary (citable) accession number: Q96MM7
Secondary accession number(s): B9WRT4
, B9WRT5, E9PDY5, Q2TB13, Q4VC07, Q6PIC4, Q86SM9, Q8N3T4, Q8NBN4, Q96SJ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: October 11, 2005
Last modified: September 3, 2014
This is version 92 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi