Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96MI6

- PPM1M_HUMAN

UniProt

Q96MI6 - PPM1M_HUMAN

Protein

Protein phosphatase 1M

Gene

PPM1M

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 107 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalytic activityi

    [a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

    Cofactori

    Magnesium or manganese.Curated

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi223 – 2231ManganeseSequence Analysis

    GO - Molecular functioni

    1. CTD phosphatase activity Source: UniProtKB
    2. manganese ion binding Source: UniProtKB

    GO - Biological processi

    1. protein dephosphorylation Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Magnesium, Manganese, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein phosphatase 1M (EC:3.1.3.16)
    Alternative name(s):
    Protein phosphatase 2C isoform eta
    Short name:
    PP2C-eta
    Short name:
    PP2CE
    Gene namesi
    Name:PPM1M
    Synonyms:PPM1E
    OrganismiHomo sapiens (Human)Imported
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:26506. PPM1M.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671151.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 270270Protein phosphatase 1MPRO_0000057756Add
    BLAST

    Proteomic databases

    PaxDbiQ96MI6.
    PRIDEiQ96MI6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96MI6.
    BgeeiQ96MI6.
    CleanExiHS_PPM1E.
    HS_PPM1M.
    GenevestigatoriQ96MI6.

    Organism-specific databases

    HPAiHPA036905.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000387046.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96MI6.
    SMRiQ96MI6. Positions 17-246.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 192192PP2C-likeAdd
    BLAST

    Sequence similaritiesi

    Belongs to the PP2C family.Curated
    Contains 1 PP2C-like domain.Curated

    Phylogenomic databases

    eggNOGiCOG0631.
    HOGENOMiHOG000251606.
    HOVERGENiHBG105802.
    InParanoidiQ96MI6.
    KOiK17507.
    PhylomeDBiQ96MI6.
    TreeFamiTF314700.

    Family and domain databases

    Gene3Di3.60.40.10. 2 hits.
    InterProiIPR001932. PP2C-like_dom.
    IPR015655. Protein_Pase_2C.
    [Graphical view]
    PANTHERiPTHR13832. PTHR13832. 1 hit.
    PfamiPF00481. PP2C. 2 hits.
    [Graphical view]
    SMARTiSM00332. PP2Cc. 1 hit.
    [Graphical view]
    SUPFAMiSSF81606. SSF81606. 2 hits.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1Curated (identifier: Q96MI6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG    50
    QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR 100
    IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE 150
    KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP 200
    QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH 250
    RYCSCWGPAW AWVGASSKPK 270

    Note: No experimental confirmation available.Curated

    Length:270
    Mass (Da):30,375
    Last modified:December 1, 2001 - v1
    Checksum:iFCBE6EDF7C127144
    GO
    Isoform 2Curated (identifier: Q96MI6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
         124-270: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:123
    Mass (Da):13,330
    Checksum:i8821EC221BBEA624
    GO
    Isoform 3Curated (identifier: Q96MI6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-129: Missing.
         130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
         252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

    Note: No experimental confirmation available.Curated

    Show »
    Length:169
    Mass (Da):18,837
    Checksum:iFCBC85A80A95B7A8
    GO
    Isoform 4Curated (identifier: Q96MI6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-51: Missing.
         252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

    Note: No experimental confirmation available.Curated

    Show »
    Length:247
    Mass (Da):27,923
    Checksum:i4738FD6CBF4613BB
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 129129Missing in isoform 3. 1 PublicationVSP_050660Add
    BLAST
    Alternative sequencei1 – 5151Missing in isoform 4. 1 PublicationVSP_050659Add
    BLAST
    Alternative sequencei105 – 12319AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. 1 PublicationVSP_050663Add
    BLAST
    Alternative sequencei124 – 270147Missing in isoform 2. 1 PublicationVSP_050664Add
    BLAST
    Alternative sequencei130 – 14415LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. 1 PublicationVSP_050661Add
    BLAST
    Alternative sequencei252 – 27019YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. 2 PublicationsVSP_050662Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056894 mRNA. Translation: BAB71302.1.
    AK096681 mRNA. Translation: BAC04839.1.
    AK129647 mRNA. Translation: BAC85206.1.
    BC009644 mRNA. Translation: AAH09644.1.
    CCDSiCCDS46840.1. [Q96MI6-4]
    RefSeqiNP_001116342.1. NM_001122870.2. [Q96MI6-4]
    NP_653242.3. NM_144641.3.
    UniGeneiHs.373560.
    Hs.731914.

    Genome annotation databases

    EnsembliENST00000296487; ENSP00000296487; ENSG00000164088. [Q96MI6-1]
    ENST00000409502; ENSP00000387046; ENSG00000164088. [Q96MI6-4]
    GeneIDi132160.
    KEGGihsa:132160.
    UCSCiuc003ddf.4. human. [Q96MI6-1]
    uc003ddg.4. human. [Q96MI6-4]
    uc003ddh.4. human. [Q96MI6-3]

    Polymorphism databases

    DMDMi41688718.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056894 mRNA. Translation: BAB71302.1 .
    AK096681 mRNA. Translation: BAC04839.1 .
    AK129647 mRNA. Translation: BAC85206.1 .
    BC009644 mRNA. Translation: AAH09644.1 .
    CCDSi CCDS46840.1. [Q96MI6-4 ]
    RefSeqi NP_001116342.1. NM_001122870.2. [Q96MI6-4 ]
    NP_653242.3. NM_144641.3.
    UniGenei Hs.373560.
    Hs.731914.

    3D structure databases

    ProteinModelPortali Q96MI6.
    SMRi Q96MI6. Positions 17-246.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000387046.

    Polymorphism databases

    DMDMi 41688718.

    Proteomic databases

    PaxDbi Q96MI6.
    PRIDEi Q96MI6.

    Protocols and materials databases

    DNASUi 132160.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000296487 ; ENSP00000296487 ; ENSG00000164088 . [Q96MI6-1 ]
    ENST00000409502 ; ENSP00000387046 ; ENSG00000164088 . [Q96MI6-4 ]
    GeneIDi 132160.
    KEGGi hsa:132160.
    UCSCi uc003ddf.4. human. [Q96MI6-1 ]
    uc003ddg.4. human. [Q96MI6-4 ]
    uc003ddh.4. human. [Q96MI6-3 ]

    Organism-specific databases

    CTDi 132160.
    GeneCardsi GC03P052279.
    HGNCi HGNC:26506. PPM1M.
    HPAi HPA036905.
    MIMi 608979. gene.
    neXtProti NX_Q96MI6.
    PharmGKBi PA142671151.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0631.
    HOGENOMi HOG000251606.
    HOVERGENi HBG105802.
    InParanoidi Q96MI6.
    KOi K17507.
    PhylomeDBi Q96MI6.
    TreeFami TF314700.

    Miscellaneous databases

    GenomeRNAii 132160.
    NextBioi 83025.
    PROi Q96MI6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96MI6.
    Bgeei Q96MI6.
    CleanExi HS_PPM1E.
    HS_PPM1M.
    Genevestigatori Q96MI6.

    Family and domain databases

    Gene3Di 3.60.40.10. 2 hits.
    InterProi IPR001932. PP2C-like_dom.
    IPR015655. Protein_Pase_2C.
    [Graphical view ]
    PANTHERi PTHR13832. PTHR13832. 1 hit.
    Pfami PF00481. PP2C. 2 hits.
    [Graphical view ]
    SMARTi SM00332. PP2Cc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF81606. SSF81606. 2 hits.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Peripheral blood, Prostate and Thymus.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: UterusImported.

    Entry informationi

    Entry nameiPPM1M_HUMAN
    AccessioniPrimary (citable) accession number: Q96MI6
    Secondary accession number(s): Q8N8J9, Q96DB8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 2, 2004
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 107 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3