Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96MI6 (PPM1M_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 106. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein phosphatase 1M

EC=3.1.3.16
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name=PP2C-eta
Short name=PP2CE
Gene names
Name:PPM1M
Synonyms:PPM1E
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length270 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactor

Magnesium or manganese Potential.

Subcellular location

Nucleus By similarity UniProtKB Q8BU27.

Sequence similarities

Belongs to the PP2C family.

Contains 1 PP2C-like domain.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandMagnesium
Manganese
Metal-binding
   Molecular functionHydrolase
Protein phosphatase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processprotein dephosphorylation

Inferred from sequence or structural similarity. Source: UniProtKB

   Cellular_componentnucleus

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionCTD phosphatase activity

Inferred from sequence or structural similarity. Source: UniProtKB

manganese ion binding

Inferred from sequence or structural similarity. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96MI6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q96MI6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96MI6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96MI6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 270270Protein phosphatase 1M
PRO_0000057756

Regions

Domain1 – 192192PP2C-like

Sites

Metal binding2231Manganese Potential UniProtKB P35813

Natural variations

Alternative sequence1 – 129129Missing in isoform 3.
VSP_050660
Alternative sequence1 – 5151Missing in isoform 4.
VSP_050659
Alternative sequence105 – 12319AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2.
VSP_050663
Alternative sequence124 – 270147Missing in isoform 2.
VSP_050664
Alternative sequence130 – 14415LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3.
VSP_050661
Alternative sequence252 – 27019YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4.
VSP_050662

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: FCBE6EDF7C127144

FASTA27030,375
        10         20         30         40         50         60 
MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG QMGGCTALVA 

        70         80         90        100        110        120 
VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR IQQLAFVYPE LLAGEFTRLE 

       130        140        150        160        170        180 
FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE KSDLKYPLIH GQGRQARLLG TLAVSRGLGD 

       190        200        210        220        230        240 
HQLRVLDTNI QLKPFLLSVP QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS 

       250        260        270 
FLPGNQEDPH RYCSCWGPAW AWVGASSKPK 

« Hide

Isoform 2 [UniParc].

Checksum: 8821EC221BBEA624
Show »

FASTA12313,330
Isoform 3 [UniParc].

Checksum: FCBC85A80A95B7A8
Show »

FASTA16918,837
Isoform 4 [UniParc].

Checksum: 4738FD6CBF4613BB
Show »

FASTA24727,923

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Peripheral blood, Prostate and Thymus.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Uterus.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK056894 mRNA. Translation: BAB71302.1.
AK096681 mRNA. Translation: BAC04839.1.
AK129647 mRNA. Translation: BAC85206.1.
BC009644 mRNA. Translation: AAH09644.1.
CCDSCCDS46840.1. [Q96MI6-4]
RefSeqNP_001116342.1. NM_001122870.2. [Q96MI6-4]
NP_653242.3. NM_144641.3.
UniGeneHs.373560.
Hs.731914.

3D structure databases

ProteinModelPortalQ96MI6.
SMRQ96MI6. Positions 17-246.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000387046.

Polymorphism databases

DMDM41688718.

Proteomic databases

PaxDbQ96MI6.
PRIDEQ96MI6.

Protocols and materials databases

DNASU132160.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000296487; ENSP00000296487; ENSG00000164088. [Q96MI6-1]
ENST00000409502; ENSP00000387046; ENSG00000164088. [Q96MI6-4]
GeneID132160.
KEGGhsa:132160.
UCSCuc003ddf.4. human. [Q96MI6-1]
uc003ddg.4. human. [Q96MI6-4]
uc003ddh.4. human. [Q96MI6-3]

Organism-specific databases

CTD132160.
GeneCardsGC03P052279.
HGNCHGNC:26506. PPM1M.
HPAHPA036905.
MIM608979. gene.
neXtProtNX_Q96MI6.
PharmGKBPA142671151.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0631.
HOGENOMHOG000251606.
HOVERGENHBG105802.
InParanoidQ96MI6.
KOK17507.
PhylomeDBQ96MI6.
TreeFamTF314700.

Gene expression databases

ArrayExpressQ96MI6.
BgeeQ96MI6.
CleanExHS_PPM1E.
HS_PPM1M.
GenevestigatorQ96MI6.

Family and domain databases

Gene3D3.60.40.10. 2 hits.
InterProIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERPTHR13832. PTHR13832. 1 hit.
PfamPF00481. PP2C. 2 hits.
[Graphical view]
SMARTSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMSSF81606. SSF81606. 2 hits.
ProtoNetSearch...

Other

GenomeRNAi132160.
NextBio83025.
PROQ96MI6.
SOURCESearch...

Entry information

Entry namePPM1M_HUMAN
AccessionPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
Entry history
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM