Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MI6

- PPM1M_HUMAN

UniProt

Q96MI6 - PPM1M_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein phosphatase 1M

Gene

PPM1M

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Mg2+Curated, Mn2+Curated

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi223 – 2231ManganeseSequence Analysis

GO - Molecular functioni

  1. CTD phosphatase activity Source: UniProtKB
  2. manganese ion binding Source: UniProtKB

GO - Biological processi

  1. protein dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1M (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name:
PP2C-eta
Short name:
PP2CE
Gene namesi
Name:PPM1M
Synonyms:PPM1E
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Unplaced

Organism-specific databases

HGNCiHGNC:26506. PPM1M.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671151.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 270270Protein phosphatase 1MPRO_0000057756Add
BLAST

Proteomic databases

PaxDbiQ96MI6.
PRIDEiQ96MI6.

Expressioni

Gene expression databases

BgeeiQ96MI6.
CleanExiHS_PPM1E.
HS_PPM1M.
ExpressionAtlasiQ96MI6. baseline and differential.
GenevestigatoriQ96MI6.

Organism-specific databases

HPAiHPA036905.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000387046.

Structurei

3D structure databases

ProteinModelPortaliQ96MI6.
SMRiQ96MI6. Positions 17-246.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 192192PP2C-likeAdd
BLAST

Sequence similaritiesi

Belongs to the PP2C family.Curated
Contains 1 PP2C-like domain.Curated

Phylogenomic databases

eggNOGiCOG0631.
GeneTreeiENSGT00530000063231.
HOGENOMiHOG000251606.
HOVERGENiHBG105802.
InParanoidiQ96MI6.
KOiK17507.
PhylomeDBiQ96MI6.
TreeFamiTF314700.

Family and domain databases

Gene3Di3.60.40.10. 2 hits.
InterProiIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 2 hits.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 2 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1Curated (identifier: Q96MI6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG
60 70 80 90 100
QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR
110 120 130 140 150
IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE
160 170 180 190 200
KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP
210 220 230 240 250
QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH
260 270
RYCSCWGPAW AWVGASSKPK

Note: No experimental confirmation available.Curated

Length:270
Mass (Da):30,375
Last modified:December 1, 2001 - v1
Checksum:iFCBE6EDF7C127144
GO
Isoform 2Curated (identifier: Q96MI6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:123
Mass (Da):13,330
Checksum:i8821EC221BBEA624
GO
Isoform 3Curated (identifier: Q96MI6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated

Show »
Length:169
Mass (Da):18,837
Checksum:iFCBC85A80A95B7A8
GO
Isoform 4Curated (identifier: Q96MI6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated

Show »
Length:247
Mass (Da):27,923
Checksum:i4738FD6CBF4613BB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 129129Missing in isoform 3. 1 PublicationVSP_050660Add
BLAST
Alternative sequencei1 – 5151Missing in isoform 4. 1 PublicationVSP_050659Add
BLAST
Alternative sequencei105 – 12319AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. 1 PublicationVSP_050663Add
BLAST
Alternative sequencei124 – 270147Missing in isoform 2. 1 PublicationVSP_050664Add
BLAST
Alternative sequencei130 – 14415LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. 1 PublicationVSP_050661Add
BLAST
Alternative sequencei252 – 27019YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. 2 PublicationsVSP_050662Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA. Translation: BAB71302.1.
AK096681 mRNA. Translation: BAC04839.1.
AK129647 mRNA. Translation: BAC85206.1.
BC009644 mRNA. Translation: AAH09644.1.
CCDSiCCDS46840.1. [Q96MI6-4]
RefSeqiNP_001116342.1. NM_001122870.2. [Q96MI6-4]
NP_653242.3. NM_144641.3.
UniGeneiHs.373560.
Hs.731914.

Genome annotation databases

GeneIDi132160.
KEGGihsa:132160.
UCSCiuc003ddf.4. human. [Q96MI6-1]
uc003ddg.4. human. [Q96MI6-4]
uc003ddh.4. human. [Q96MI6-3]

Polymorphism databases

DMDMi41688718.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA. Translation: BAB71302.1 .
AK096681 mRNA. Translation: BAC04839.1 .
AK129647 mRNA. Translation: BAC85206.1 .
BC009644 mRNA. Translation: AAH09644.1 .
CCDSi CCDS46840.1. [Q96MI6-4 ]
RefSeqi NP_001116342.1. NM_001122870.2. [Q96MI6-4 ]
NP_653242.3. NM_144641.3.
UniGenei Hs.373560.
Hs.731914.

3D structure databases

ProteinModelPortali Q96MI6.
SMRi Q96MI6. Positions 17-246.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000387046.

Polymorphism databases

DMDMi 41688718.

Proteomic databases

PaxDbi Q96MI6.
PRIDEi Q96MI6.

Protocols and materials databases

DNASUi 132160.
Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 132160.
KEGGi hsa:132160.
UCSCi uc003ddf.4. human. [Q96MI6-1 ]
uc003ddg.4. human. [Q96MI6-4 ]
uc003ddh.4. human. [Q96MI6-3 ]

Organism-specific databases

CTDi 132160.
GeneCardsi GC03P052279.
HGNCi HGNC:26506. PPM1M.
HPAi HPA036905.
MIMi 608979. gene.
neXtProti NX_Q96MI6.
PharmGKBi PA142671151.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0631.
GeneTreei ENSGT00530000063231.
HOGENOMi HOG000251606.
HOVERGENi HBG105802.
InParanoidi Q96MI6.
KOi K17507.
PhylomeDBi Q96MI6.
TreeFami TF314700.

Miscellaneous databases

ChiTaRSi PPM1M. human.
GenomeRNAii 132160.
NextBioi 83025.
PROi Q96MI6.
SOURCEi Search...

Gene expression databases

Bgeei Q96MI6.
CleanExi HS_PPM1E.
HS_PPM1M.
ExpressionAtlasi Q96MI6. baseline and differential.
Genevestigatori Q96MI6.

Family and domain databases

Gene3Di 3.60.40.10. 2 hits.
InterProi IPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view ]
PANTHERi PTHR13832. PTHR13832. 1 hit.
Pfami PF00481. PP2C. 2 hits.
[Graphical view ]
SMARTi SM00332. PP2Cc. 1 hit.
[Graphical view ]
SUPFAMi SSF81606. SSF81606. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Peripheral blood, Prostate and Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: UterusImported.

Entry informationi

Entry nameiPPM1M_HUMAN
AccessioniPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: November 26, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3