Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1M

Gene

PPM1M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Mg2+Curated, Mn2+Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi223ManganeseSequence analysis1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMagnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1M (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name:
PP2C-eta
Short name:
PP2CE
Gene namesi
Name:PPM1M
Synonyms:PPM1E
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000164088.17
HGNCiHGNC:26506 PPM1M
MIMi608979 gene
neXtProtiNX_Q96MI6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000164088
PharmGKBiPA142671151

Polymorphism and mutation databases

BioMutaiPPM1M
DMDMi41688718

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000577561 – 270Protein phosphatase 1MAdd BLAST270

Proteomic databases

PaxDbiQ96MI6
PeptideAtlasiQ96MI6
PRIDEiQ96MI6
ProteomicsDBi77361
77362 [Q96MI6-2]
77363 [Q96MI6-3]
77364 [Q96MI6-4]

PTM databases

DEPODiQ96MI6
iPTMnetiQ96MI6
PhosphoSitePlusiQ96MI6

Expressioni

Gene expression databases

BgeeiENSG00000164088
CleanExiHS_PPM1E
HS_PPM1M
ExpressionAtlasiQ96MI6 baseline and differential
GenevisibleiQ96MI6 HS

Organism-specific databases

HPAiHPA036905
HPA062291

Interactioni

Protein-protein interaction databases

BioGridi126308, 4 interactors
IntActiQ96MI6, 4 interactors
STRINGi9606.ENSP00000387046

Structurei

3D structure databases

ProteinModelPortaliQ96MI6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 270PPM-type phosphatasePROSITE-ProRule annotationAdd BLAST270

Sequence similaritiesi

Belongs to the PP2C family.Curated

Phylogenomic databases

eggNOGiKOG1323 Eukaryota
ENOG410XP4B LUCA
GeneTreeiENSGT00530000063231
HOGENOMiHOG000251606
HOVERGENiHBG105802
InParanoidiQ96MI6
KOiK17507
PhylomeDBiQ96MI6
TreeFamiTF314700

Family and domain databases

CDDicd00143 PP2Cc, 1 hit
InterProiView protein in InterPro
IPR015655 PP2C
IPR036457 PPM-type_dom_sf
IPR001932 PPM-type_phosphatase_dom
PANTHERiPTHR13832 PTHR13832, 1 hit
PfamiView protein in Pfam
PF00481 PP2C, 2 hits
SMARTiView protein in SMART
SM00332 PP2Cc, 1 hit
SUPFAMiSSF81606 SSF81606, 2 hits
PROSITEiView protein in PROSITE
PS51746 PPM_2, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: Q96MI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG
60 70 80 90 100
QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR
110 120 130 140 150
IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE
160 170 180 190 200
KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP
210 220 230 240 250
QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH
260 270
RYCSCWGPAW AWVGASSKPK
Note: No experimental confirmation available.Curated
Length:270
Mass (Da):30,375
Last modified:December 1, 2001 - v1
Checksum:iFCBE6EDF7C127144
GO
Isoform 2Curated (identifier: Q96MI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:123
Mass (Da):13,330
Checksum:i8821EC221BBEA624
GO
Isoform 3Curated (identifier: Q96MI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated
Show »
Length:169
Mass (Da):18,837
Checksum:iFCBC85A80A95B7A8
GO
Isoform 4Curated (identifier: Q96MI6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated
Show »
Length:247
Mass (Da):27,923
Checksum:i4738FD6CBF4613BB
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0506601 – 129Missing in isoform 3. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_0506591 – 51Missing in isoform 4. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_050663105 – 123AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_050664124 – 270Missing in isoform 2. 1 PublicationAdd BLAST147
Alternative sequenceiVSP_050661130 – 144LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_050662252 – 270YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. 2 PublicationsAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA Translation: BAB71302.1
AK096681 mRNA Translation: BAC04839.1
AK129647 mRNA Translation: BAC85206.1
BC009644 mRNA Translation: AAH09644.1
CCDSiCCDS46840.1 [Q96MI6-4]
RefSeqiNP_001116342.1, NM_001122870.2 [Q96MI6-4]
NP_653242.3, NM_144641.3
UniGeneiHs.373560
Hs.731914

Genome annotation databases

EnsembliENST00000296487; ENSP00000296487; ENSG00000164088 [Q96MI6-1]
ENST00000409502; ENSP00000387046; ENSG00000164088 [Q96MI6-4]
GeneIDi132160
KEGGihsa:132160
UCSCiuc003ddf.4 human [Q96MI6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPPM1M_HUMAN
AccessioniPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: June 20, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health