Q96MI6 (PPM1M_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein phosphatase 1M EC=3.1.3.16 Alternative name(s): Protein phosphatase 2C isoform eta Short name=PP2C-eta Short name=PP2CE | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 270 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. UniProtKB Q8BU27 |
| Cofactor | Magnesium or manganese Potential. |
| Subcellular location | Nucleus By similarity UniProtKB Q8BU27. |
| Sequence similarities | Belongs to the PP2C family. Contains 1 PP2C-like domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Manganese Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein dephosphorylation Inferred from sequence or structural similarity. Source: UniProtKB |
| Cellular_component | nucleus Inferred from sequence or structural similarity. Source: UniProtKB |
| Molecular_function | CTD phosphatase activity Inferred from sequence or structural similarity. Source: UniProtKB manganese ion bindingInferred from sequence or structural similarity. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MI6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q96MI6-2) The sequence of this isoform differs from the canonical sequence as follows: 105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP 124-270: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96MI6-3) The sequence of this isoform differs from the canonical sequence as follows: 1-129: Missing. 130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR 252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q96MI6-4) The sequence of this isoform differs from the canonical sequence as follows: 1-51: Missing. 252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 270 | 270 | Protein phosphatase 1M | PRO_0000057756 | |||||
Regions | |||||||||
| Domain | 1 – 192 | 192 | PP2C-like | ||||||
Sites | |||||||||
| Metal binding | 223 | 1 | Manganese Potential UniProtKB P35813 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 129 | 129 | Missing in isoform 3. | VSP_050660 | |||||
| Alternative sequence | 1 – 51 | 51 | Missing in isoform 4. | VSP_050659 | |||||
| Alternative sequence | 105 – 123 | 19 | AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. | VSP_050663 | |||||
| Alternative sequence | 124 – 270 | 147 | Missing in isoform 2. | VSP_050664 | |||||
| Alternative sequence | 130 – 144 | 15 | LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. | VSP_050661 | |||||
| Alternative sequence | 252 – 270 | 19 | YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. | VSP_050662 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Peripheral blood, Prostate and Thymus. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Uterus. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK056894 mRNA. Translation: BAB71302.1. AK096681 mRNA. Translation: BAC04839.1. AK129647 mRNA. Translation: BAC85206.1. BC009644 mRNA. Translation: AAH09644.1. |
| IPI | IPI00165163. IPI00167493. IPI00398744. IPI00942895. |
| RefSeq | NP_001116342.1. NM_001122870.2. NP_653242.3. NM_144641.3. |
| UniGene | Hs.373560. Hs.731914. |
3D structure databases | |
| ProteinModelPortal | Q96MI6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000387046. |
Polymorphism databases | |
| DMDM | 41688718. |
Proteomic databases | |
| PaxDb | Q96MI6. |
| PRIDE | Q96MI6. |
Protocols and materials databases | |
| DNASU | 132160. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000296487; ENSP00000296487; ENSG00000164088. ENST00000409502; ENSP00000387046; ENSG00000164088. |
| GeneID | 132160. |
| KEGG | hsa:132160. |
| UCSC | uc003ddf.4. human. uc003ddg.4. human. uc003ddh.4. human. |
Organism-specific databases | |
| CTD | 132160. |
| GeneCards | GC03P052279. |
| HGNC | HGNC:26506. PPM1M. |
| HPA | HPA036905. |
| MIM | 608979. gene. |
| neXtProt | NX_Q96MI6. |
| PharmGKB | PA142671151. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0631. |
| HOGENOM | HOG000251606. |
| HOVERGEN | HBG105802. |
| InParanoid | Q96MI6. |
| KO | K01090. |
| PhylomeDB | Q96MI6. |
Gene expression databases | |
| ArrayExpress | Q96MI6. |
| Bgee | Q96MI6. |
| CleanEx | HS_PPM1E. HS_PPM1M. |
| Genevestigator | Q96MI6. |
| GermOnline | ENSG00000164088. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.60.40.10. 2 hits. |
| InterPro | IPR001932. PP2C-like. IPR015655. Protein_Pase_2C. [Graphical view] |
| PANTHER | PTHR13832. PTHR13832. 1 hit. |
| Pfam | PF00481. PP2C. 2 hits. [Graphical view] |
| SMART | SM00332. PP2Cc. 1 hit. [Graphical view] |
| SUPFAM | SSF81606. PP2C-related. 1 hit. |
| PROSITE | PS01032. PP2C. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 132160. |
| NextBio | 83025. |
| SOURCE | Search... |
Entry information
| Entry name | PPM1M_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MI6 Secondary accession number(s): Q8N8J9, Q96DB8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
