Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein phosphatase 1M

Gene

PPM1M

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Mg2+Curated, Mn2+Curated

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi223 – 2231ManganeseSequence Analysis

GO - Molecular functioni

  1. CTD phosphatase activity Source: UniProtKB
  2. manganese ion binding Source: UniProtKB

GO - Biological processi

  1. protein dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1M (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name:
PP2C-eta
Short name:
PP2CE
Gene namesi
Name:PPM1M
Synonyms:PPM1E
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:26506. PPM1M.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671151.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 270270Protein phosphatase 1MPRO_0000057756Add
BLAST

Proteomic databases

PaxDbiQ96MI6.
PRIDEiQ96MI6.

PTM databases

DEPODiQ96MI6.

Expressioni

Gene expression databases

BgeeiQ96MI6.
CleanExiHS_PPM1E.
HS_PPM1M.
ExpressionAtlasiQ96MI6. baseline and differential.
GenevestigatoriQ96MI6.

Organism-specific databases

HPAiHPA036905.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000387046.

Structurei

3D structure databases

ProteinModelPortaliQ96MI6.
SMRiQ96MI6. Positions 17-246.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 270270PPM-type phosphatasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the PP2C family.Curated
Contains 1 PPM-type phosphatase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0631.
GeneTreeiENSGT00530000063231.
HOGENOMiHOG000251606.
HOVERGENiHBG105802.
InParanoidiQ96MI6.
KOiK17507.
PhylomeDBiQ96MI6.
TreeFamiTF314700.

Family and domain databases

Gene3Di3.60.40.10. 2 hits.
InterProiIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 2 hits.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 2 hits.
PROSITEiPS51746. PPM_2. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: Q96MI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG
60 70 80 90 100
QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR
110 120 130 140 150
IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE
160 170 180 190 200
KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP
210 220 230 240 250
QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH
260 270
RYCSCWGPAW AWVGASSKPK

Note: No experimental confirmation available.Curated

Length:270
Mass (Da):30,375
Last modified:December 1, 2001 - v1
Checksum:iFCBE6EDF7C127144
GO
Isoform 2Curated (identifier: Q96MI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.

Note: No experimental confirmation available.Curated

Show »
Length:123
Mass (Da):13,330
Checksum:i8821EC221BBEA624
GO
Isoform 3Curated (identifier: Q96MI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated

Show »
Length:169
Mass (Da):18,837
Checksum:iFCBC85A80A95B7A8
GO
Isoform 4Curated (identifier: Q96MI6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.Curated

Show »
Length:247
Mass (Da):27,923
Checksum:i4738FD6CBF4613BB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 129129Missing in isoform 3. 1 PublicationVSP_050660Add
BLAST
Alternative sequencei1 – 5151Missing in isoform 4. 1 PublicationVSP_050659Add
BLAST
Alternative sequencei105 – 12319AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2. 1 PublicationVSP_050663Add
BLAST
Alternative sequencei124 – 270147Missing in isoform 2. 1 PublicationVSP_050664Add
BLAST
Alternative sequencei130 – 14415LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3. 1 PublicationVSP_050661Add
BLAST
Alternative sequencei252 – 27019YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4. 2 PublicationsVSP_050662Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA. Translation: BAB71302.1.
AK096681 mRNA. Translation: BAC04839.1.
AK129647 mRNA. Translation: BAC85206.1.
BC009644 mRNA. Translation: AAH09644.1.
CCDSiCCDS46840.1. [Q96MI6-4]
RefSeqiNP_001116342.1. NM_001122870.2. [Q96MI6-4]
NP_653242.3. NM_144641.3.
UniGeneiHs.373560.
Hs.731914.

Genome annotation databases

GeneIDi132160.
KEGGihsa:132160.
UCSCiuc003ddf.4. human. [Q96MI6-1]
uc003ddg.4. human. [Q96MI6-4]
uc003ddh.4. human. [Q96MI6-3]

Polymorphism databases

DMDMi41688718.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056894 mRNA. Translation: BAB71302.1.
AK096681 mRNA. Translation: BAC04839.1.
AK129647 mRNA. Translation: BAC85206.1.
BC009644 mRNA. Translation: AAH09644.1.
CCDSiCCDS46840.1. [Q96MI6-4]
RefSeqiNP_001116342.1. NM_001122870.2. [Q96MI6-4]
NP_653242.3. NM_144641.3.
UniGeneiHs.373560.
Hs.731914.

3D structure databases

ProteinModelPortaliQ96MI6.
SMRiQ96MI6. Positions 17-246.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000387046.

PTM databases

DEPODiQ96MI6.

Polymorphism databases

DMDMi41688718.

Proteomic databases

PaxDbiQ96MI6.
PRIDEiQ96MI6.

Protocols and materials databases

DNASUi132160.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi132160.
KEGGihsa:132160.
UCSCiuc003ddf.4. human. [Q96MI6-1]
uc003ddg.4. human. [Q96MI6-4]
uc003ddh.4. human. [Q96MI6-3]

Organism-specific databases

CTDi132160.
GeneCardsiGC03P052279.
HGNCiHGNC:26506. PPM1M.
HPAiHPA036905.
MIMi608979. gene.
neXtProtiNX_Q96MI6.
PharmGKBiPA142671151.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0631.
GeneTreeiENSGT00530000063231.
HOGENOMiHOG000251606.
HOVERGENiHBG105802.
InParanoidiQ96MI6.
KOiK17507.
PhylomeDBiQ96MI6.
TreeFamiTF314700.

Miscellaneous databases

ChiTaRSiPPM1M. human.
GenomeRNAii132160.
NextBioi83025.
PROiQ96MI6.
SOURCEiSearch...

Gene expression databases

BgeeiQ96MI6.
CleanExiHS_PPM1E.
HS_PPM1M.
ExpressionAtlasiQ96MI6. baseline and differential.
GenevestigatoriQ96MI6.

Family and domain databases

Gene3Di3.60.40.10. 2 hits.
InterProiIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 2 hits.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 2 hits.
PROSITEiPS51746. PPM_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Peripheral blood, Prostate and Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: UterusImported.

Entry informationi

Entry nameiPPM1M_HUMAN
AccessioniPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: April 1, 2015
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.