SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96MI6

- PPM1M_HUMAN

UniProt

Q96MI6 - PPM1M_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein phosphatase 1M
Gene
PPM1M, PPM1E
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Magnesium or manganese Reviewed prediction.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi223 – 2231Manganese Reviewed predictionBy similarity

GO - Molecular functioni

  1. CTD phosphatase activity Source: UniProtKB
  2. manganese ion binding Source: UniProtKB

GO - Biological processi

  1. protein dephosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protein phosphatase

Keywords - Ligandi

Magnesium, Manganese, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Protein phosphatase 1M (EC:3.1.3.16)
Alternative name(s):
Protein phosphatase 2C isoform eta
Short name:
PP2C-eta
Short name:
PP2CE
Gene namesi
Name:PPM1M
Synonyms:PPM1E
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:26506. PPM1M.

Subcellular locationi

Nucleus By similarity By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671151.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 270270Protein phosphatase 1M
PRO_0000057756Add
BLAST

Proteomic databases

PaxDbiQ96MI6.
PRIDEiQ96MI6.

Expressioni

Gene expression databases

ArrayExpressiQ96MI6.
BgeeiQ96MI6.
CleanExiHS_PPM1E.
HS_PPM1M.
GenevestigatoriQ96MI6.

Organism-specific databases

HPAiHPA036905.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000387046.

Structurei

3D structure databases

ProteinModelPortaliQ96MI6.
SMRiQ96MI6. Positions 17-246.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 192192PP2C-like
Add
BLAST

Sequence similaritiesi

Belongs to the PP2C family.
Contains 1 PP2C-like domain.

Phylogenomic databases

eggNOGiCOG0631.
HOGENOMiHOG000251606.
HOVERGENiHBG105802.
InParanoidiQ96MI6.
KOiK17507.
PhylomeDBiQ96MI6.
TreeFamiTF314700.

Family and domain databases

Gene3Di3.60.40.10. 2 hits.
InterProiIPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view]
PANTHERiPTHR13832. PTHR13832. 1 hit.
PfamiPF00481. PP2C. 2 hits.
[Graphical view]
SMARTiSM00332. PP2Cc. 1 hit.
[Graphical view]
SUPFAMiSSF81606. SSF81606. 2 hits.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96MI6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MHLNGRCICP SDPQFVEEKG IRAEDLVIGA LESAFQECDE VIGRELEASG    50
QMGGCTALVA VSLQGKLYMA NAGDSRAILV RRDEIRPLSF EFTPETERQR 100
IQQLAFVYPE LLAGEFTRLE FPRRLKGDDL GQKVLFRDHH MSGWSYKRVE 150
KSDLKYPLIH GQGRQARLLG TLAVSRGLGD HQLRVLDTNI QLKPFLLSVP 200
QVTVLDVDQL ELQEDDVVVM ATDGLWDVLS NEQVAWLVRS FLPGNQEDPH 250
RYCSCWGPAW AWVGASSKPK 270

Note: No experimental confirmation available.

Length:270
Mass (Da):30,375
Last modified:December 1, 2001 - v1
Checksum:iFCBE6EDF7C127144
GO
Isoform 2 (identifier: Q96MI6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-123: AFVYPELLAGEFTRLEFPR → VGALGSMEAVKLQLLGPGP
     124-270: Missing.

Note: No experimental confirmation available.

Show »
Length:123
Mass (Da):13,330
Checksum:i8821EC221BBEA624
GO
Isoform 3 (identifier: Q96MI6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-129: Missing.
     130-144: LGQKVLFRDHHMSGW → MGHRAWVDAGSAPGR
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.

Show »
Length:169
Mass (Da):18,837
Checksum:iFCBC85A80A95B7A8
GO
Isoform 4 (identifier: Q96MI6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     252-270: YCSCWGPAWAWVGASSKPK → FSKLAQMLIHSTQGKEDSLTEEGQVSYDDVSVFVIPLHSQGQESSDH

Note: No experimental confirmation available.

Show »
Length:247
Mass (Da):27,923
Checksum:i4738FD6CBF4613BB
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 129129Missing in isoform 3.
VSP_050660Add
BLAST
Alternative sequencei1 – 5151Missing in isoform 4.
VSP_050659Add
BLAST
Alternative sequencei105 – 12319AFVYP…LEFPR → VGALGSMEAVKLQLLGPGP in isoform 2.
VSP_050663Add
BLAST
Alternative sequencei124 – 270147Missing in isoform 2.
VSP_050664Add
BLAST
Alternative sequencei130 – 14415LGQKV…HMSGW → MGHRAWVDAGSAPGR in isoform 3.
VSP_050661Add
BLAST
Alternative sequencei252 – 27019YCSCW…SSKPK → FSKLAQMLIHSTQGKEDSLT EEGQVSYDDVSVFVIPLHSQ GQESSDH in isoform 3 and isoform 4.
VSP_050662Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056894 mRNA. Translation: BAB71302.1.
AK096681 mRNA. Translation: BAC04839.1.
AK129647 mRNA. Translation: BAC85206.1.
BC009644 mRNA. Translation: AAH09644.1.
CCDSiCCDS46840.1. [Q96MI6-4]
RefSeqiNP_001116342.1. NM_001122870.2. [Q96MI6-4]
NP_653242.3. NM_144641.3.
UniGeneiHs.373560.
Hs.731914.

Genome annotation databases

EnsembliENST00000296487; ENSP00000296487; ENSG00000164088. [Q96MI6-1]
ENST00000409502; ENSP00000387046; ENSG00000164088. [Q96MI6-4]
GeneIDi132160.
KEGGihsa:132160.
UCSCiuc003ddf.4. human. [Q96MI6-1]
uc003ddg.4. human. [Q96MI6-4]
uc003ddh.4. human. [Q96MI6-3]

Polymorphism databases

DMDMi41688718.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056894 mRNA. Translation: BAB71302.1 .
AK096681 mRNA. Translation: BAC04839.1 .
AK129647 mRNA. Translation: BAC85206.1 .
BC009644 mRNA. Translation: AAH09644.1 .
CCDSi CCDS46840.1. [Q96MI6-4 ]
RefSeqi NP_001116342.1. NM_001122870.2. [Q96MI6-4 ]
NP_653242.3. NM_144641.3.
UniGenei Hs.373560.
Hs.731914.

3D structure databases

ProteinModelPortali Q96MI6.
SMRi Q96MI6. Positions 17-246.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000387046.

Polymorphism databases

DMDMi 41688718.

Proteomic databases

PaxDbi Q96MI6.
PRIDEi Q96MI6.

Protocols and materials databases

DNASUi 132160.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000296487 ; ENSP00000296487 ; ENSG00000164088 . [Q96MI6-1 ]
ENST00000409502 ; ENSP00000387046 ; ENSG00000164088 . [Q96MI6-4 ]
GeneIDi 132160.
KEGGi hsa:132160.
UCSCi uc003ddf.4. human. [Q96MI6-1 ]
uc003ddg.4. human. [Q96MI6-4 ]
uc003ddh.4. human. [Q96MI6-3 ]

Organism-specific databases

CTDi 132160.
GeneCardsi GC03P052279.
HGNCi HGNC:26506. PPM1M.
HPAi HPA036905.
MIMi 608979. gene.
neXtProti NX_Q96MI6.
PharmGKBi PA142671151.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0631.
HOGENOMi HOG000251606.
HOVERGENi HBG105802.
InParanoidi Q96MI6.
KOi K17507.
PhylomeDBi Q96MI6.
TreeFami TF314700.

Miscellaneous databases

GenomeRNAii 132160.
NextBioi 83025.
PROi Q96MI6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96MI6.
Bgeei Q96MI6.
CleanExi HS_PPM1E.
HS_PPM1M.
Genevestigatori Q96MI6.

Family and domain databases

Gene3Di 3.60.40.10. 2 hits.
InterProi IPR001932. PP2C-like_dom.
IPR015655. Protein_Pase_2C.
[Graphical view ]
PANTHERi PTHR13832. PTHR13832. 1 hit.
Pfami PF00481. PP2C. 2 hits.
[Graphical view ]
SMARTi SM00332. PP2Cc. 1 hit.
[Graphical view ]
SUPFAMi SSF81606. SSF81606. 2 hits.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Peripheral blood, Prostate and Thymus.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Uterus.

Entry informationi

Entry nameiPPM1M_HUMAN
AccessioniPrimary (citable) accession number: Q96MI6
Secondary accession number(s): Q8N8J9, Q96DB8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi