Q96MF6 (CQ10A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Coenzyme Q-binding protein COQ10 homolog A, mitochondrial | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 247 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes Probable. Ref.4 |
| Subunit structure | Interacts with coenzyme Q By similarity. |
| Subcellular location | Mitochondrion inner membrane; Peripheral membrane protein; Matrix side By similarity. |
| Sequence similarities | Belongs to the COQ10 family. |
| Sequence caution | The sequence AAQ89220.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrial inner membrane Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96MF6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96MF6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-44: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPM → MHSSSPSPTNDRGLRRTIRLAPLSFGL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 15 | 15 | Mitochondrion Potential | ||||||
| Chain | 16 – 247 | 232 | Coenzyme Q-binding protein COQ10 homolog A, mitochondrial | PRO_0000228644 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 44 | 44 | MAWAG…PPRPM → MHSSSPSPTNDRGLRRTIRL APLSFGL in isoform 2. | VSP_017685 | |||||
| Natural variant | 79 | 1 | P → H. Ref.2 Corresponds to variant rs11543258 [ dbSNP | Ensembl ]. | VAR_025703 | |||||
| Natural variant | 231 | 1 | P → S. Corresponds to variant rs3184994 [ dbSNP | Ensembl ]. | VAR_048828 | |||||
Experimental info | |||||||||
| Sequence conflict | 38 | 1 | L → P in BAB71339. Ref.1 | ||||||
| Sequence conflict | 202 | 1 | H → R in BAB71339. Ref.1 | ||||||
| Sequence conflict | 213 | 1 | V → A in BAB71339. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Skeletal muscle. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT HIS-79. Tissue: Brain, Colon and Skin. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-247 (ISOFORM 1). |
| [4] | "The Saccharomyces cerevisiae COQ10 gene encodes a START domain protein required for function of coenzyme Q in respiration." Barros M.H., Johnson A., Gin P., Marbois B.N., Clarke C.F., Tzagoloff A. J. Biol. Chem. 280:42627-42635(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PROBABLE FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK057003 mRNA. Translation: BAB71339.1. AK057014 mRNA. Translation: BAB71344.1. BC002435 mRNA. Translation: AAH02435.2. BC047444 mRNA. Translation: AAH47444.1. BC073923 mRNA. Translation: AAH73923.1. AY358861 mRNA. Translation: AAQ89220.1. Different initiation. |
| IPI | IPI00065495. IPI00736624. |
| RefSeq | NP_653177.3. NM_144576.3. |
| UniGene | Hs.4096. |
3D structure databases | |
| ProteinModelPortal | Q96MF6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-6942683. |
| STRING | 9606.ENSP00000312587. |
PTM databases | |
| PhosphoSite | Q96MF6. |
Polymorphism databases | |
| DMDM | 90111993. |
Proteomic databases | |
| PaxDb | Q96MF6. |
| PRIDE | Q96MF6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000308197; ENSP00000312587; ENSG00000135469. ENST00000546544; ENSP00000446723; ENSG00000135469. |
| GeneID | 93058. |
| KEGG | hsa:93058. |
| UCSC | uc001sko.4. human. uc001skq.4. human. |
Organism-specific databases | |
| CTD | 93058. |
| GeneCards | GC12P056660. |
| HGNC | HGNC:26515. COQ10A. |
| neXtProt | NX_Q96MF6. |
| PharmGKB | PA143485439. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2867. |
| HOGENOM | HOG000261732. |
| HOVERGEN | HBG081329. |
| OMA | MQEMFEV. |
| OrthoDB | EOG4Q84Z9. |
Gene expression databases | |
| ArrayExpress | Q96MF6. |
| Bgee | Q96MF6. |
| CleanEx | HS_COQ10A. |
| Genevestigator | Q96MF6. |
| GermOnline | ENSG00000135469. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.530.20. 1 hit. |
| InterPro | IPR005031. Polyket_cyc. IPR023393. START-like_dom. [Graphical view] |
| Pfam | PF03364. Polyketide_cyc. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 93058. |
| NextBio | 77957. |
Entry information
| Entry name | CQ10A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96MF6 Secondary accession number(s): Q6GMR6 Q9BUP4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
