Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C16orf45

Gene

C16orf45

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C16orf45
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000166780.10
HGNCiHGNC:19213 C16orf45
neXtProtiNX_Q96MC5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000166780
PharmGKBiPA134973206

Polymorphism and mutation databases

BioMutaiC16orf45
DMDMi68565261

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000792811 – 204Uncharacterized protein C16orf45Add BLAST204

Proteomic databases

MaxQBiQ96MC5
PaxDbiQ96MC5
PeptideAtlasiQ96MC5
PRIDEiQ96MC5

PTM databases

iPTMnetiQ96MC5
PhosphoSitePlusiQ96MC5

Expressioni

Gene expression databases

BgeeiENSG00000166780
CleanExiHS_C16orf45
ExpressionAtlasiQ96MC5 baseline and differential
GenevisibleiQ96MC5 HS

Organism-specific databases

HPAiHPA041114

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124644, 22 interactors
IntActiQ96MC5, 5 interactors

Structurei

3D structure databases

ProteinModelPortaliQ96MC5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 150bMERBPROSITE-ProRule annotationAdd BLAST148

Phylogenomic databases

eggNOGiENOG410IDZ0 Eukaryota
ENOG4111I1T LUCA
GeneTreeiENSGT00440000038745
HOGENOMiHOG000234055
HOVERGENiHBG080747
InParanoidiQ96MC5
OMAiIIKDCCG
OrthoDBiEOG091G0OUN
PhylomeDBiQ96MC5
TreeFamiTF331543

Family and domain databases

InterProiView protein in InterPro
IPR022735 bMERB_dom
PfamiView protein in Pfam
PF12130 DUF3585, 1 hit
PROSITEiView protein in PROSITE
PS51848 BMERB, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96MC5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELKQSLSTH LEAEKPLRRY GAVEETAWKT ERLGRNQLDI ISMAETTMMP
60 70 80 90 100
EEIELEMAKI QRLREVLVRR ESELRFMMDD IQLCKDIMDL KQELQNLVAI
110 120 130 140 150
PEKEKTKLQK QREDELIQKI HKLVQKRDFL VDDAEVERLR EQEEDKEMAD
160 170 180 190 200
FLRIKLKPLD KVTKSPASSR AEKKAEPPPS KPTVAKTGLA LIKDCCGATQ

CNIM
Length:204
Mass (Da):23,732
Last modified:December 1, 2001 - v1
Checksum:i5D702950A7744A5F
GO
Isoform 2 (identifier: Q96MC5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MELKQSLSTHLEAEKPLRRYGAVEETAWKTERLGRN → MWGDLTETGCMGRRSAKKD

Note: No experimental confirmation available.
Show »
Length:187
Mass (Da):21,645
Checksum:i585EC26D4080ADD8
GO

Sequence cautioni

The sequence AAC31663 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0472321 – 36MELKQ…RLGRN → MWGDLTETGCMGRRSAKKD in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057180 mRNA Translation: BAB71376.1
U95740 Genomic DNA Translation: AAC31663.1 Sequence problems.
BC008967 mRNA Translation: AAH08967.2
BC023603 mRNA Translation: AAH23603.2
CCDSiCCDS10561.1 [Q96MC5-1]
CCDS45422.1 [Q96MC5-2]
RefSeqiNP_001135941.1, NM_001142469.1 [Q96MC5-2]
NP_149978.1, NM_033201.2 [Q96MC5-1]
UniGeneiHs.401798

Genome annotation databases

EnsembliENST00000300006; ENSP00000300006; ENSG00000166780 [Q96MC5-1]
ENST00000452191; ENSP00000408976; ENSG00000166780 [Q96MC5-2]
ENST00000610499; ENSP00000477880; ENSG00000278823 [Q96MC5-2]
ENST00000615273; ENSP00000483858; ENSG00000278823 [Q96MC5-1]
GeneIDi89927
KEGGihsa:89927
UCSCiuc002ddo.4 human [Q96MC5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCP045_HUMAN
AccessioniPrimary (citable) accession number: Q96MC5
Secondary accession number(s): O00223
, O75769, Q8IZ36, Q96H25
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: May 23, 2018
This is version 120 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health