Q96M96 (FGD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 91.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FYVE, RhoGEF and PH domain-containing protein 4 Alternative name(s): Actin filament-binding protein frabin FGD1-related F-actin-binding protein Zinc finger FYVE domain-containing protein 6 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 766 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. Plays a role in regulating the actin cytoskeleton and cell shape. Activates MAPK8 By similarity. Ref.4 |
| Subunit structure | Homooligomer By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton By similarity. Cell projection › filopodium By similarity. Note: Concentrated in filopodia and poorly detected at lamellipodia. Binds along the sides of actin fibers By similarity. |
| Tissue specificity | Expressed in different tissues, including brain, cerebellum, peripheral nerve, skeletal muscle, heart, uterus, placenta and testis. Ref.5 |
| Domain | The part of the protein spanning the actin filament-binding domain together with the DH domain and the first PH domain is necessary and sufficient for microspike formation. Activation of MAPK8 requires the presence of all domains with the exception of the actin filament-binding domain By similarity. |
| Involvement in disease | Defects in FGD4 are the cause of Charcot-Marie-Tooth disease type 4H (CMT4H) [MIM:609311]; also known as Charcot-Marie-Tooth disease neuropathy type 4H. CMT4H is a recessive demyelinating form of Charcot-Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy and primary peripheral axonal neuropathy. Demyelinating CMT neuropathies are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. By convention, autosomal recessive forms of demyelinating Charcot-Marie-Tooth disease are designated CMT4. Ref.5 Ref.6 |
| Sequence similarities | Contains 1 DH (DBL-homology) domain. Contains 1 FYVE-type zinc finger. Contains 2 PH domains. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q96M96-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96M96-2) The sequence of this isoform differs from the canonical sequence as follows: 1-248: Missing. 515-766: ALQETIDAFH...HPEPKKKSEC → RRGFAMLPRLISNS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96M96-3) The sequence of this isoform differs from the canonical sequence as follows: 1-30: MEEIKPASASCVSKEKPSKVSDLISRFEGG → MFSCFLCILSF 201-207: ETNEQKL → VEHETSS 208-766: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 766 | 766 | FYVE, RhoGEF and PH domain-containing protein 4 | PRO_0000080947 | |||||
Regions | |||||||||
| Domain | 206 – 393 | 188 | DH | ||||||
| Domain | 422 – 521 | 100 | PH 1 | ||||||
| Domain | 643 – 740 | 98 | PH 2 | ||||||
| Zinc finger | 559 – 619 | 61 | FYVE-type | ||||||
| Region | 1 – 150 | 150 | Actin filament-binding By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 702 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 248 | 248 | Missing in isoform 2. | VSP_013078 | |||||
| Alternative sequence | 1 – 30 | 30 | MEEIK…RFEGG → MFSCFLCILSF in isoform 3. | VSP_013079 | |||||
| Alternative sequence | 201 – 207 | 7 | ETNEQKL → VEHETSS in isoform 3. | VSP_013080 | |||||
| Alternative sequence | 208 – 766 | 559 | Missing in isoform 3. | VSP_013081 | |||||
| Alternative sequence | 515 – 766 | 252 | ALQET…KKSEC → RRGFAMLPRLISNS in isoform 2. | VSP_013082 | |||||
| Natural variant | 298 | 1 | M → R in fibroblasts from a CMT4H patient; absent from patient's peripheral nerve where splicing defects and aberrant transcripts are detected. Ref.5 Ref.6 | VAR_034957 | |||||
| Natural variant | 298 | 1 | M → T in CMT4H. Ref.5 | VAR_044321 | |||||
Experimental info | |||||||||
| Sequence conflict | 79 | 1 | T → A in BAB71413. Ref.2 | ||||||
| Sequence conflict | 303 | 1 | V → A in AAQ72372. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY367054 mRNA. Translation: AAQ72372.1. AK057294 mRNA. Translation: BAB71413.1. AL713762 mRNA. Translation: CAD28532.1. |
| IPI | IPI00065435. IPI00429579. IPI00940940. |
| RefSeq | NP_640334.2. NM_139241.2. |
| UniGene | Hs.117835. |
3D structure databases | |
| ProteinModelPortal | Q96M96. |
| SMR | Q96M96. Positions 205-519, 547-620, 639-746. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96M96. |
PTM databases | |
| PhosphoSite | Q96M96. |
Polymorphism databases | |
| DMDM | 116241363. |
Proteomic databases | |
| PRIDE | Q96M96. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000427716; ENSP00000394487; ENSG00000139132. |
| GeneID | 121512. |
| KEGG | hsa:121512. |
| NMPDR | fig|9606.3.peg.7377. |
| UCSC | uc001rkx.2. human. uc001rkz.1. human. |
Organism-specific databases | |
| CTD | 121512. |
| GeneCards | GC12P032546. |
| H-InvDB | HIX0201846. |
| HGNC | HGNC:19125. FGD4. |
| HPA | HPA039235. |
| MIM | 609311. phenotype. 611104. gene. |
| neXtProt | NX_Q96M96. |
| Orphanet | 99954. Charcot-Marie-Tooth disease type 4H. |
| PharmGKB | PA134907925. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00550000074235. |
| HOVERGEN | HBG007506. |
| InParanoid | Q96M96. |
| OMA | TLDDHPE. |
| OrthoDB | EOG418BMQ. |
| PhylomeDB | Q96M96. |
Enzyme and pathway databases | |
| Reactome | REACT_111102. Signal Transduction. |
Gene expression databases | |
| ArrayExpress | Q96M96. |
| Bgee | Q96M96. |
| CleanEx | HS_FGD4. |
| Genevestigator | Q96M96. |
| GermOnline | ENSG00000139132. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000219. DH-domain. IPR011993. PH_type. IPR001849. Pleckstrin_homology. IPR000306. Znf_FYVE. IPR017455. Znf_FYVE-rel. IPR011011. Znf_FYVE_PHD. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 2 hits. G3DSA:1.20.900.10. RhoGEF. 1 hit. G3DSA:3.30.40.10. Znf_RING/FYVE/PHD. 1 hit. |
| KO | K05723. |
| Pfam | PF01363. FYVE. 1 hit. PF00169. PH. 2 hits. PF00621. RhoGEF. 1 hit. [Graphical view] |
| SMART | SM00064. FYVE. 1 hit. SM00233. PH. 2 hits. SM00325. RhoGEF. 1 hit. [Graphical view] |
| SUPFAM | SSF48065. DH-domain. 1 hit. SSF57903. FYVE_PHD_ZnF. 1 hit. |
| PROSITE | PS50010. DH_2. 1 hit. PS50003. PH_DOMAIN. 2 hits. PS50178. ZF_FYVE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 80759. |
| SOURCE | Search... |
Entry information
| Entry name | FGD4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96M96 Secondary accession number(s): Q6ULS2, Q8TCP6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with