Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein PRRC1

Gene

PRRC1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein PRRC1
Alternative name(s):
Proline-rich and coiled-coil-containing protein 1
Gene namesi
Name:PRRC1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:28164. PRRC1.

Subcellular locationi

  • Golgi apparatus 1 Publication

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162400175.

Polymorphism and mutation databases

BioMutaiPRRC1.
DMDMi74732288.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 445445Protein PRRC1PRO_0000307338Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei408 – 4081PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96M27.
MaxQBiQ96M27.
PaxDbiQ96M27.
PRIDEiQ96M27.

PTM databases

iPTMnetiQ96M27.
PhosphoSiteiQ96M27.

Expressioni

Tissue specificityi

Isoform 4 is specifically expressed in liver. Ubiquitously expressed with higher expression in kidney, liver and placenta.1 Publication

Gene expression databases

BgeeiQ96M27.
CleanExiHS_PRRC1.
GenevisibleiQ96M27. HS.

Organism-specific databases

HPAiHPA039212.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PIN1Q135263EBI-2560879,EBI-714158
SEC23BQ154373EBI-2560879,EBI-742673

Protein-protein interaction databases

BioGridi126367. 28 interactions.
IntActiQ96M27. 5 interactions.
MINTiMINT-5001825.
STRINGi9606.ENSP00000296666.

Structurei

3D structure databases

ProteinModelPortaliQ96M27.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi11 – 129119Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the PRRC1 family.Curated

Phylogenomic databases

eggNOGiENOG410IHF5. Eukaryota.
ENOG410ZN4R. LUCA.
GeneTreeiENSGT00390000003837.
HOVERGENiHBG055574.
InParanoidiQ96M27.
OMAiAIAGMYK.
OrthoDBiEOG73BVCZ.
PhylomeDBiQ96M27.
TreeFamiTF343676.

Family and domain databases

Gene3Di3.90.950.10. 1 hit.
InterProiIPR029001. ITPase-like_fam.
IPR026533. NTPase/PRRC1.
IPR026534. PRRC1.
[Graphical view]
PANTHERiPTHR23276. PTHR23276. 1 hit.
PfamiPF01931. NTPase_I-T. 1 hit.
[Graphical view]
SUPFAMiSSF52972. SSF52972. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96M27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MMEESGIETT PPGTPPPNPA GLAATAMSST PVPLAATSSF SSPNVSSMES
60 70 80 90 100
FPPLAYSTPQ PPLPPVRPSA PLPFVPPPAV PSVPPLVTSM PPPVSPSTAA
110 120 130 140 150
AFGNPPVSHF PPSTSAPNTL LPAPPSGPPI SGFSVGSTYD ITRGHAGRAP
160 170 180 190 200
QTPLMPSFSA PSGTGLLPTP ITQQASLTSL AQGTGTTSAI TFPEEQEDPR
210 220 230 240 250
ITRGQDEASA GGIWGFIKGV AGNPMVKSVL DKTKHSVESM ITTLDPGMAP
260 270 280 290 300
YIKSGGELDI VVTSNKEVKV AAVRDAFQEV FGLAVVVGEA GQSNIAPQPV
310 320 330 340 350
GYAAGLKGAQ ERIDSLRRTG VIHEKQTAVS VENFIAELLP DKWFDIGCLV
360 370 380 390 400
VEDPVHGIHL ETFTQATPVP LEFVQQAQSL TPQDYNLRWS GLLVTVGEVL
410 420 430 440
EKSLLNVSRT DWHMAFTGMS RRQMIYSAAR AIAGMYKQRL PPRTV
Length:445
Mass (Da):46,701
Last modified:December 1, 2001 - v1
Checksum:i68FFE2C1992A2361
GO
Isoform 2 (identifier: Q96M27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     433-445: AGMYKQRLPPRTV → ENPQRAVAVHGLVEARNFPAPGDLVSLLLGTV

Note: Non-canonical splice sites for exon 9 and exon 10.
Show »
Length:464
Mass (Da):48,525
Checksum:i29D15F64361FA999
GO
Isoform 3 (identifier: Q96M27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     434-445: GMYKQRLPPRTV → DDYFPRIPKEQWQSMAWLKLEIFLPLVTW

Show »
Length:462
Mass (Da):48,907
Checksum:i2C98812E953CCB20
GO
Isoform 4 (identifier: Q96M27-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     311-311: E → A
     312-445: Missing.

Show »
Length:311
Mass (Da):31,426
Checksum:i82B7869DA6AB0D28
GO
Isoform 5 (identifier: Q96M27-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     377-377: A → VGFLLCFFIMLQRNLHYCFQNKNLFGFFVRNMFLILFQSFFF
     378-445: Missing.

Note: No experimental confirmation available.
Show »
Length:418
Mass (Da):44,084
Checksum:i4845139EE2F0110D
GO

Sequence cautioni

The sequence AAH17066.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC03467.1 differs from that shown. Reason: Frameshift at position 156. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti70 – 701A → T in CAH10384 (PubMed:17974005).Curated
Sequence conflicti338 – 3381L → S in CAH10384 (PubMed:17974005).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei311 – 3111E → A in isoform 4. 1 PublicationVSP_028720
Alternative sequencei312 – 445134Missing in isoform 4. 1 PublicationVSP_028721Add
BLAST
Alternative sequencei377 – 3771A → VGFLLCFFIMLQRNLHYCFQ NKNLFGFFVRNMFLILFQSF FF in isoform 5. 1 PublicationVSP_028722
Alternative sequencei378 – 44568Missing in isoform 5. 1 PublicationVSP_028723Add
BLAST
Alternative sequencei433 – 44513AGMYK…PPRTV → ENPQRAVAVHGLVEARNFPA PGDLVSLLLGTV in isoform 2. 1 PublicationVSP_028724Add
BLAST
Alternative sequencei434 – 44512GMYKQ…PPRTV → DDYFPRIPKEQWQSMAWLKL EIFLPLVTW in isoform 3. 1 PublicationVSP_028725Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ427339 mRNA. Translation: CAD22113.1.
AJ441110 mRNA. Translation: CAD29585.2.
AJ496322 mRNA. Translation: CAD42881.1.
AJ515158 mRNA. Translation: CAD56470.1.
AJ515428 mRNA. Translation: CAD56438.1.
AJ515429 mRNA. Translation: CAD56439.1.
AK090486 mRNA. Translation: BAC03467.1. Frameshift.
AK057437 mRNA. Translation: BAB71487.1.
AL831963 mRNA. Translation: CAD38605.1.
AL832600 mRNA. Translation: CAH10384.1. Different termination.
CH471062 Genomic DNA. Translation: EAW62402.1.
CH471062 Genomic DNA. Translation: EAW62405.1.
BC017066 mRNA. Translation: AAH17066.1. Different initiation.
CCDSiCCDS4143.1. [Q96M27-1]
CCDS68943.1. [Q96M27-3]
RefSeqiNP_001273737.1. NM_001286808.1. [Q96M27-3]
NP_570721.1. NM_130809.4. [Q96M27-1]
XP_006714592.1. XM_006714529.2. [Q96M27-1]
UniGeneiHs.483259.

Genome annotation databases

EnsembliENST00000296666; ENSP00000296666; ENSG00000164244. [Q96M27-1]
ENST00000442138; ENSP00000392873; ENSG00000164244. [Q96M27-5]
ENST00000512635; ENSP00000421965; ENSG00000164244. [Q96M27-3]
GeneIDi133619.
KEGGihsa:133619.
UCSCiuc003kuj.6. human. [Q96M27-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ427339 mRNA. Translation: CAD22113.1.
AJ441110 mRNA. Translation: CAD29585.2.
AJ496322 mRNA. Translation: CAD42881.1.
AJ515158 mRNA. Translation: CAD56470.1.
AJ515428 mRNA. Translation: CAD56438.1.
AJ515429 mRNA. Translation: CAD56439.1.
AK090486 mRNA. Translation: BAC03467.1. Frameshift.
AK057437 mRNA. Translation: BAB71487.1.
AL831963 mRNA. Translation: CAD38605.1.
AL832600 mRNA. Translation: CAH10384.1. Different termination.
CH471062 Genomic DNA. Translation: EAW62402.1.
CH471062 Genomic DNA. Translation: EAW62405.1.
BC017066 mRNA. Translation: AAH17066.1. Different initiation.
CCDSiCCDS4143.1. [Q96M27-1]
CCDS68943.1. [Q96M27-3]
RefSeqiNP_001273737.1. NM_001286808.1. [Q96M27-3]
NP_570721.1. NM_130809.4. [Q96M27-1]
XP_006714592.1. XM_006714529.2. [Q96M27-1]
UniGeneiHs.483259.

3D structure databases

ProteinModelPortaliQ96M27.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126367. 28 interactions.
IntActiQ96M27. 5 interactions.
MINTiMINT-5001825.
STRINGi9606.ENSP00000296666.

PTM databases

iPTMnetiQ96M27.
PhosphoSiteiQ96M27.

Polymorphism and mutation databases

BioMutaiPRRC1.
DMDMi74732288.

Proteomic databases

EPDiQ96M27.
MaxQBiQ96M27.
PaxDbiQ96M27.
PRIDEiQ96M27.

Protocols and materials databases

DNASUi133619.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296666; ENSP00000296666; ENSG00000164244. [Q96M27-1]
ENST00000442138; ENSP00000392873; ENSG00000164244. [Q96M27-5]
ENST00000512635; ENSP00000421965; ENSG00000164244. [Q96M27-3]
GeneIDi133619.
KEGGihsa:133619.
UCSCiuc003kuj.6. human. [Q96M27-1]

Organism-specific databases

CTDi133619.
GeneCardsiPRRC1.
H-InvDBHIX0005138.
HGNCiHGNC:28164. PRRC1.
HPAiHPA039212.
neXtProtiNX_Q96M27.
PharmGKBiPA162400175.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHF5. Eukaryota.
ENOG410ZN4R. LUCA.
GeneTreeiENSGT00390000003837.
HOVERGENiHBG055574.
InParanoidiQ96M27.
OMAiAIAGMYK.
OrthoDBiEOG73BVCZ.
PhylomeDBiQ96M27.
TreeFamiTF343676.

Miscellaneous databases

ChiTaRSiPRRC1. human.
GenomeRNAii133619.
NextBioi83254.
PROiQ96M27.

Gene expression databases

BgeeiQ96M27.
CleanExiHS_PRRC1.
GenevisibleiQ96M27. HS.

Family and domain databases

Gene3Di3.90.950.10. 1 hit.
InterProiIPR029001. ITPase-like_fam.
IPR026533. NTPase/PRRC1.
IPR026534. PRRC1.
[Graphical view]
PANTHERiPTHR23276. PTHR23276. 1 hit.
PfamiPF01931. NTPase_I-T. 1 hit.
[Graphical view]
SUPFAMiSSF52972. SSF52972. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Structural analysis and expression profile of a novel gene on chromosome 5q23 encoding a Golgi-associated protein with six splice variants, and involved within the 5q deletion of a Ph(-) CML patient."
    Kamakari S., Roussou A., Jefferson A., Ragoussis I., Anagnou N.P.
    Leuk. Res. 29:17-31(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Heart, Liver and Peripheral blood.
  2. "The nucleotide sequence of a long cDNA clone isolated from human spleen."
    Jikuya H., Takano J., Kikuno R., Nagase T., Ohara O.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spleen.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Skeletal muscle and Spinal cord.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-408, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiPRRC1_HUMAN
AccessioniPrimary (citable) accession number: Q96M27
Secondary accession number(s): Q69YM8
, Q7L2U7, Q86Y42, Q8IVJ4, Q8IVL4, Q8NEZ7, Q96AJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: December 1, 2001
Last modified: May 11, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.