Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Regulator of microtubule dynamics protein 2

Gene

RMDN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Regulator of microtubule dynamics protein 2
Short name:
RMD-2
Short name:
hRMD-2
Alternative name(s):
Protein FAM82A1
Gene namesi
Name:RMDN2
Synonyms:FAM82A, FAM82A1
ORF Names:BLOCK18, UNQ9371/PRO34163
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:26567. RMDN2.

Subcellular locationi

  • Membrane Curated; Single-pass membrane protein Curated
  • Cytoplasm 1 Publication
  • Cytoplasmcytoskeletonspindle 1 Publication
  • Cytoplasmcytoskeletonspindle pole 1 Publication

  • Note: In interphase localizes in the cytoplasm, and during mitosis localizes to the spindle microtubules and spindle poles. Also detected as large dots in the perinuclear region.

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei9 – 28HelicalSequence analysisAdd BLAST20

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi151393.
OpenTargetsiENSG00000115841.
PharmGKBiPA162387925.

Polymorphism and mutation databases

BioMutaiRMDN2.
DMDMi147643051.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002875041 – 410Regulator of microtubule dynamics protein 2Add BLAST410

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei51PhosphoserineBy similarity1
Modified residuei121PhosphoserineBy similarity1
Modified residuei139PhosphothreonineCombined sources1
Modified residuei152PhosphotyrosineCombined sources1
Modified residuei154PhosphothreonineCombined sources1
Modified residuei157PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96LZ7.
MaxQBiQ96LZ7.
PaxDbiQ96LZ7.
PeptideAtlasiQ96LZ7.
PRIDEiQ96LZ7.

PTM databases

iPTMnetiQ96LZ7.
PhosphoSitePlusiQ96LZ7.

Expressioni

Gene expression databases

BgeeiENSG00000115841.
CleanExiHS_FAM82A1.
ExpressionAtlasiQ96LZ7. baseline and differential.
GenevisibleiQ96LZ7. HS.

Organism-specific databases

HPAiHPA034705.
HPA034706.

Interactioni

Subunit structurei

Interacts with microtubules.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
AGTRAPQ6RW133EBI-2806908,EBI-741181
CMTM5Q96DZ93EBI-2806908,EBI-2548702
VAPBQ53XM73EBI-2806908,EBI-10178947

Protein-protein interaction databases

BioGridi127373. 9 interactors.
IntActiQ96LZ7. 9 interactors.
STRINGi9606.ENSP00000234195.

Structurei

3D structure databases

ProteinModelPortaliQ96LZ7.
SMRiQ96LZ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili68 – 110Sequence analysisAdd BLAST43

Sequence similaritiesi

Belongs to the RMDN family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J8TA. Eukaryota.
ENOG411167M. LUCA.
GeneTreeiENSGT00530000063162.
HOVERGENiHBG072518.
InParanoidiQ96LZ7.
OMAiVIFQERQ.
PhylomeDBiQ96LZ7.
TreeFamiTF315854.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR011990. TPR-like_helical_dom.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LZ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPYSTNKELI LGIMVGTAGI SLLLLWYHKV RKPGIAMKLP EFLSLGNTFN
60 70 80 90 100
SITLQDEIHD DQGTTVIFQE RQLQILEKLN ELLTNMEELK EEIRFLKEAI
110 120 130 140 150
PKLEEYIQDE LGGKITVHKI SPQHRARKRR LPTIQSSATS NSSEEAESEG
160 170 180 190 200
GYITANTDTE EQSFPVPKAF NTRVEELNLD VLLQKVDHLR MSESGKSESF
210 220 230 240 250
ELLRDHKEKF RDEIEFMWRF ARAYGDMYEL STNTQEKKHY ANIGKTLSER
260 270 280 290 300
AINRAPMNGH CHLWYAVLCG YVSEFEGLQN KINYGHLFKE HLDIAIKLLP
310 320 330 340 350
EEPFLYYLKG RYCYTVSKLS WIEKKMAATL FGKIPSSTVQ EALHNFLKAE
360 370 380 390 400
ELCPGYSNPN YMYLAKCYTD LEENQNALKF CNLALLLPTV TKEDKEAQKE
410
MQKIMTSLKR
Length:410
Mass (Da):47,399
Last modified:May 15, 2007 - v2
Checksum:iDE5249E5808CA42A
GO
Isoform 2 (identifier: Q96LZ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: MPYSTNKELI...SSEEAESEGG → MGKCLSCCKE...SSPIEIPKIR
     394-410: DKEAQKEMQKIMTSLKR → EL

Show »
Length:573
Mass (Da):65,170
Checksum:i249BFF67E72C7F40
GO
Isoform 3 (identifier: Q96LZ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: MPYSTNKELI...SSEEAESEGG → MGKCLR
     349-410: AEELCPGYSNPNYMYLAKCYTDLEENQNALKFCNLALLLPTVTKEDKEAQKEMQKIMTSLKR → VHFVYPLF

Note: No experimental confirmation available.
Show »
Length:211
Mass (Da):24,806
Checksum:iA3C86418A2644414
GO
Isoform 4 (identifier: Q96LZ7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: MPYSTNKELI...SSEEAESEGG → MGKCLR

Show »
Length:265
Mass (Da):30,961
Checksum:iB2DE94C98C9542EF
GO

Sequence cautioni

The sequence AAM81211 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q96LZ7-2)
Sequence conflicti259G → D in BAB71517 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032316259G → D.1 PublicationCorresponds to variant rs4670800dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0255241 – 151MPYST…ESEGG → MGKCLSCCKEDQSFQRCSPE DQVSTDAQHRGASSISQPSI SLGHKTSYSPVTHKVNAAKA SRRLLSVSSPSFSERRYSLF VGFQKRNASPYWQQSRANFD SEEDTGFTDIKSSSDHCGSF ISRRRRFSSRKLSIVSYYKS AIFFDPQASGQNVFNLNEIE IFSKTSSNTDAKKHITISAP EYNTKNFKNFETNTTSPAFG NTIDTASYQQSTSSFFSLAS DISSPDQQNGIANDIQQRGQ LCKDLKDFLHPRPESYSTGH SPIMIPQHPSQSGTFPFLHK AGFSSSYKNSGCFIPPQSEL TSGLFEDEDFAVLFQDEDRS SPIEIPKIR in isoform 2. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0255251 – 151MPYST…ESEGG → MGKCLR in isoform 3 and isoform 4. 2 PublicationsAdd BLAST151
Alternative sequenceiVSP_025526349 – 410AEELC…TSLKR → VHFVYPLF in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_025527394 – 410DKEAQ…TSLKR → EL in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057516 mRNA. Translation: BAB71517.1.
AK095462 mRNA. Translation: BAC04551.1.
AY358269 mRNA. Translation: AAQ88636.1.
AF435956 mRNA. Translation: AAM20907.1.
AC009229 Genomic DNA. No translation available.
AC016689 Genomic DNA. Translation: AAX88865.1.
CH471053 Genomic DNA. Translation: EAX00385.1.
CH471053 Genomic DNA. Translation: EAX00387.1.
BC024243 mRNA. Translation: AAH24243.3.
AH011736 Genomic DNA. Translation: AAM81211.1. Sequence problems.
BR000689 mRNA. Translation: FAA00414.1.
BR000692 mRNA. Translation: FAA00417.1.
CCDSiCCDS1792.1. [Q96LZ7-2]
CCDS54351.1. [Q96LZ7-1]
CCDS54352.1. [Q96LZ7-4]
RefSeqiNP_001164262.1. NM_001170791.2. [Q96LZ7-1]
NP_001164263.1. NM_001170792.2. [Q96LZ7-1]
NP_001164264.1. NM_001170793.2. [Q96LZ7-4]
NP_001309140.1. NM_001322211.1. [Q96LZ7-1]
NP_653314.3. NM_144713.4.
XP_016858964.1. XM_017003475.1.
UniGeneiHs.591566.

Genome annotation databases

EnsembliENST00000354545; ENSP00000346549; ENSG00000115841. [Q96LZ7-1]
ENST00000406384; ENSP00000386004; ENSG00000115841. [Q96LZ7-1]
ENST00000417700; ENSP00000392977; ENSG00000115841. [Q96LZ7-4]
GeneIDi151393.
KEGGihsa:151393.
UCSCiuc002rql.4. human. [Q96LZ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK057516 mRNA. Translation: BAB71517.1.
AK095462 mRNA. Translation: BAC04551.1.
AY358269 mRNA. Translation: AAQ88636.1.
AF435956 mRNA. Translation: AAM20907.1.
AC009229 Genomic DNA. No translation available.
AC016689 Genomic DNA. Translation: AAX88865.1.
CH471053 Genomic DNA. Translation: EAX00385.1.
CH471053 Genomic DNA. Translation: EAX00387.1.
BC024243 mRNA. Translation: AAH24243.3.
AH011736 Genomic DNA. Translation: AAM81211.1. Sequence problems.
BR000689 mRNA. Translation: FAA00414.1.
BR000692 mRNA. Translation: FAA00417.1.
CCDSiCCDS1792.1. [Q96LZ7-2]
CCDS54351.1. [Q96LZ7-1]
CCDS54352.1. [Q96LZ7-4]
RefSeqiNP_001164262.1. NM_001170791.2. [Q96LZ7-1]
NP_001164263.1. NM_001170792.2. [Q96LZ7-1]
NP_001164264.1. NM_001170793.2. [Q96LZ7-4]
NP_001309140.1. NM_001322211.1. [Q96LZ7-1]
NP_653314.3. NM_144713.4.
XP_016858964.1. XM_017003475.1.
UniGeneiHs.591566.

3D structure databases

ProteinModelPortaliQ96LZ7.
SMRiQ96LZ7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127373. 9 interactors.
IntActiQ96LZ7. 9 interactors.
STRINGi9606.ENSP00000234195.

PTM databases

iPTMnetiQ96LZ7.
PhosphoSitePlusiQ96LZ7.

Polymorphism and mutation databases

BioMutaiRMDN2.
DMDMi147643051.

Proteomic databases

EPDiQ96LZ7.
MaxQBiQ96LZ7.
PaxDbiQ96LZ7.
PeptideAtlasiQ96LZ7.
PRIDEiQ96LZ7.

Protocols and materials databases

DNASUi151393.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354545; ENSP00000346549; ENSG00000115841. [Q96LZ7-1]
ENST00000406384; ENSP00000386004; ENSG00000115841. [Q96LZ7-1]
ENST00000417700; ENSP00000392977; ENSG00000115841. [Q96LZ7-4]
GeneIDi151393.
KEGGihsa:151393.
UCSCiuc002rql.4. human. [Q96LZ7-1]

Organism-specific databases

CTDi151393.
DisGeNETi151393.
GeneCardsiRMDN2.
HGNCiHGNC:26567. RMDN2.
HPAiHPA034705.
HPA034706.
MIMi611872. gene.
neXtProtiNX_Q96LZ7.
OpenTargetsiENSG00000115841.
PharmGKBiPA162387925.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J8TA. Eukaryota.
ENOG411167M. LUCA.
GeneTreeiENSGT00530000063162.
HOVERGENiHBG072518.
InParanoidiQ96LZ7.
OMAiVIFQERQ.
PhylomeDBiQ96LZ7.
TreeFamiTF315854.

Miscellaneous databases

GenomeRNAii151393.
PROiQ96LZ7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000115841.
CleanExiHS_FAM82A1.
ExpressionAtlasiQ96LZ7. baseline and differential.
GenevisibleiQ96LZ7. HS.

Family and domain databases

Gene3Di1.25.40.10. 1 hit.
InterProiIPR011990. TPR-like_helical_dom.
[Graphical view]
SUPFAMiSSF48452. SSF48452. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiRMD2_HUMAN
AccessioniPrimary (citable) accession number: Q96LZ7
Secondary accession number(s): A9UMZ7
, A9UN00, Q4ZG33, Q6UXN4, Q8N657, Q8N9A2, Q8NCV6, Q8NHM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: November 30, 2016
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.