Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock transcription factor, Y-linked

Gene

HSFY1

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Caution

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi76 – 194By similarityAdd BLAST119

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock transcription factor, Y-linked
Alternative name(s):
Heat shock transcription factor 2-like protein
Short name:
HSF2-like
Gene namesi
Name:HSFY1
Synonyms:HSF2L, HSFY
AND
Name:HSFY2
Synonyms:HSF2L, HSFY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome Y

Organism-specific databases

EuPathDBiHostDB:ENSG00000169953.11
HostDB:ENSG00000172468.13
HGNCiHGNC:18568 HSFY1
HGNC:23950 HSFY2
MIMi400029 gene
neXtProtiNX_Q96LI6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi159119
86614
GeneReviewsiHSFY1
OpenTargetsiENSG00000169953
PharmGKBiPA38580

Polymorphism and mutation databases

DMDMi27805481

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001245731 – 401Heat shock transcription factor, Y-linkedAdd BLAST401

Proteomic databases

PaxDbiQ96LI6
PeptideAtlasiQ96LI6
PRIDEiQ96LI6

PTM databases

iPTMnetiQ96LI6
PhosphoSitePlusiQ96LI6

Expressioni

Tissue specificityi

Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000169953
CleanExiHS_HSFY1
HS_HSFY2
GenevisibleiQ96LI6 HS

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi12457625 interactors.
1277331 interactor.
IntActiQ96LI6 26 interactors.
MINTiQ96LI6
STRINGi9606.ENSP00000306549

Structurei

3D structure databases

ProteinModelPortaliQ96LI6
SMRiQ96LI6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HSF family.Curated

Phylogenomic databases

eggNOGiKOG0627 Eukaryota
COG5169 LUCA
GeneTreeiENSGT00510000047153
HOGENOMiHOG000112960
HOVERGENiHBG003735
InParanoidiQ96LI6
OMAiLYGFRKM
OrthoDBiEOG091G0A49
PhylomeDBiQ96LI6
TreeFamiTF330401

Family and domain databases

Gene3Di1.10.10.101 hit
InterProiView protein in InterPro
IPR000232 HSF_DNA-bd
IPR027725 HSF_fam
IPR027730 HSFY
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PANTHERiPTHR10015 PTHR10015, 1 hit
PTHR10015:SF142 PTHR10015:SF142, 1 hit
PfamiView protein in Pfam
PF00447 HSF_DNA-bind, 1 hit
SMARTiView protein in SMART
SM00415 HSF, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV
60 70 80 90 100
LSQGSLLESP SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE
110 120 130 140 150
NGTCIVINEE LFKKEILETK APYRIFQTDA IKSFVRQLNL YGFSKIQQNF
160 170 180 190 200
QRSAFLATFL SEEKESSVLS KLKFYYNPNF KRGYPQLLVR VKRRIGVKNA
210 220 230 240 250
SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS ASKNLNMPLT
260 270 280 290 300
RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH
310 320 330 340 350
MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP
360 370 380 390 400
LVSVNEAPYR NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY

N
Length:401
Mass (Da):45,107
Last modified:December 1, 2001 - v1
Checksum:i1990C4D91E0BB277
GO
Isoform 2 (identifier: Q96LI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
     204-401: Missing.

Note: No experimental confirmation available.
Show »
Length:203
Mass (Da):23,370
Checksum:i2E011799F83827D4
GO
Isoform 3 (identifier: Q96LI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
     215-401: Missing.

Show »
Length:214
Mass (Da):24,272
Checksum:i9DAE266BD44A25CF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti94 – 99KSISWD → SLFSWE in AAK13479 (PubMed:12815422).Curated6
Sequence conflicti164K → I in AAK13479 (PubMed:12815422).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009179172 – 203LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_009180173 – 214KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_009181204 – 401Missing in isoform 2. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_009182215 – 401Missing in isoform 3. 2 PublicationsAdd BLAST187

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA Translation: CAD98806.1
AF332226 mRNA Translation: AAK13478.1
AF332227 mRNA Translation: AAK13479.1
AK058182 mRNA Translation: BAB71706.1
BC036567 mRNA Translation: AAH36567.1
BC055414 mRNA Translation: AAH55414.1
BC117380 mRNA Translation: AAI17381.1
BC117382 mRNA Translation: AAI17383.1
CCDSiCCDS14790.1 [Q96LI6-2]
CCDS14791.1 [Q96LI6-1]
CCDS35475.1 [Q96LI6-1]
CCDS35476.1 [Q96LI6-2]
RefSeqiNP_001001877.1, NM_001001877.1 [Q96LI6-2]
NP_149099.2, NM_033108.2 [Q96LI6-1]
NP_689797.1, NM_152584.1 [Q96LI6-2]
NP_714927.1, NM_153716.1 [Q96LI6-1]
XP_016885520.1, XM_017030031.1 [Q96LI6-3]
UniGeneiHs.567744
Hs.592255
Hs.662281

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953 [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468 [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468 [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468 [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953 [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953 [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468 [Q96LI6-3]
GeneIDi159119
86614
KEGGihsa:159119
hsa:86614
UCSCiuc004ftp.3 human [Q96LI6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiHSFY1_HUMAN
AccessioniPrimary (citable) accession number: Q96LI6
Secondary accession number(s): Q17RC0
, Q7Z4L8, Q9BZA2, Q9BZA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: December 1, 2001
Last modified: April 25, 2018
This is version 151 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome