Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96LI6

- HSFY1_HUMAN

UniProt

Q96LI6 - HSFY1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Heat shock transcription factor, Y-linked

Gene

HSFY1

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi76 – 194119By similarityAdd
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: InterPro

GO - Biological processi

  1. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock transcription factor, Y-linked
Alternative name(s):
Heat shock transcription factor 2-like protein
Short name:
HSF2-like
Gene namesi
Name:HSFY1
Synonyms:HSF2L, HSFY
AND
Name:HSFY2
Synonyms:HSF2L, HSFY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome Y

Organism-specific databases

HGNCiHGNC:18568. HSFY1.
HGNC:23950. HSFY2.

Subcellular locationi

Nucleus 1 Publication. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38580.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 401401Heat shock transcription factor, Y-linkedPRO_0000124573Add
BLAST

Proteomic databases

PaxDbiQ96LI6.
PRIDEiQ96LI6.

PTM databases

PhosphoSiteiQ96LI6.

Expressioni

Tissue specificityi

Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).2 Publications

Gene expression databases

BgeeiQ96LI6.
CleanExiHS_HSFY1.
HS_HSFY2.
GenevestigatoriQ96LI6.

Interactioni

Protein-protein interaction databases

BioGridi124576. 10 interactions.
127733. 1 interaction.
IntActiQ96LI6. 6 interactions.
STRINGi9606.ENSP00000303599.

Structurei

3D structure databases

ProteinModelPortaliQ96LI6.
SMRiQ96LI6. Positions 80-194.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HSF family.Curated

Phylogenomic databases

eggNOGiNOG321106.
GeneTreeiENSGT00510000047153.
HOGENOMiHOG000112960.
HOVERGENiHBG003735.
InParanoidiQ96LI6.
OMAiRTANSCF.
OrthoDBiEOG712TWS.
PhylomeDBiQ96LI6.
TreeFamiTF330401.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027721. HSFY.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF3. PTHR10015:SF3. 1 hit.
PfamiPF00447. HSF_DNA-bind. 1 hit.
[Graphical view]
SMARTiSM00415. HSF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96LI6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV
60 70 80 90 100
LSQGSLLESP SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE
110 120 130 140 150
NGTCIVINEE LFKKEILETK APYRIFQTDA IKSFVRQLNL YGFSKIQQNF
160 170 180 190 200
QRSAFLATFL SEEKESSVLS KLKFYYNPNF KRGYPQLLVR VKRRIGVKNA
210 220 230 240 250
SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS ASKNLNMPLT
260 270 280 290 300
RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH
310 320 330 340 350
MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP
360 370 380 390 400
LVSVNEAPYR NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY

N
Length:401
Mass (Da):45,107
Last modified:December 1, 2001 - v1
Checksum:i1990C4D91E0BB277
GO
Isoform 2 (identifier: Q96LI6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
     204-401: Missing.

Note: No experimental confirmation available.

Show »
Length:203
Mass (Da):23,370
Checksum:i2E011799F83827D4
GO
Isoform 3 (identifier: Q96LI6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
     215-401: Missing.

Show »
Length:214
Mass (Da):24,272
Checksum:i9DAE266BD44A25CF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti94 – 996KSISWD → SLFSWE in AAK13479. (PubMed:12815422)Curated
Sequence conflicti164 – 1641K → I in AAK13479. (PubMed:12815422)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei172 – 20332LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. 1 PublicationVSP_009179Add
BLAST
Alternative sequencei173 – 21442KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. 2 PublicationsVSP_009180Add
BLAST
Alternative sequencei204 – 401198Missing in isoform 2. 1 PublicationVSP_009181Add
BLAST
Alternative sequencei215 – 401187Missing in isoform 3. 2 PublicationsVSP_009182Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSiCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_005262623.1. XM_005262566.1. [Q96LI6-3]
UniGeneiHs.592255.
Hs.662281.

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
ENST00000624294; ENSP00000485201; ENSG00000279079. [Q96LI6-1]
ENST00000624654; ENSP00000485278; ENSG00000279680. [Q96LI6-1]
GeneIDi159119.
86614.
KEGGihsa:159119.
hsa:86614.
UCSCiuc004ftp.3. human. [Q96LI6-1]
uc004ftr.3. human. [Q96LI6-2]

Polymorphism databases

DMDMi27805481.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1 .
AF332226 mRNA. Translation: AAK13478.1 .
AF332227 mRNA. Translation: AAK13479.1 .
AK058182 mRNA. Translation: BAB71706.1 .
BC036567 mRNA. Translation: AAH36567.1 .
BC055414 mRNA. Translation: AAH55414.1 .
BC117380 mRNA. Translation: AAI17381.1 .
BC117382 mRNA. Translation: AAI17383.1 .
CCDSi CCDS14790.1. [Q96LI6-2 ]
CCDS14791.1. [Q96LI6-1 ]
CCDS35475.1. [Q96LI6-1 ]
CCDS35476.1. [Q96LI6-2 ]
RefSeqi NP_001001877.1. NM_001001877.1. [Q96LI6-2 ]
NP_149099.2. NM_033108.2. [Q96LI6-1 ]
NP_689797.1. NM_152584.1. [Q96LI6-2 ]
NP_714927.1. NM_153716.1. [Q96LI6-1 ]
XP_005262623.1. XM_005262566.1. [Q96LI6-3 ]
UniGenei Hs.592255.
Hs.662281.

3D structure databases

ProteinModelPortali Q96LI6.
SMRi Q96LI6. Positions 80-194.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124576. 10 interactions.
127733. 1 interaction.
IntActi Q96LI6. 6 interactions.
STRINGi 9606.ENSP00000303599.

PTM databases

PhosphoSitei Q96LI6.

Polymorphism databases

DMDMi 27805481.

Proteomic databases

PaxDbi Q96LI6.
PRIDEi Q96LI6.

Protocols and materials databases

DNASUi 159119.
86614.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000304790 ; ENSP00000306549 ; ENSG00000169953 . [Q96LI6-1 ]
ENST00000307393 ; ENSP00000303599 ; ENSG00000172468 . [Q96LI6-1 ]
ENST00000309834 ; ENSP00000311166 ; ENSG00000172468 . [Q96LI6-2 ]
ENST00000338876 ; ENSP00000342302 ; ENSG00000172468 . [Q96LI6-3 ]
ENST00000344884 ; ENSP00000340971 ; ENSG00000169953 . [Q96LI6-2 ]
ENST00000382852 ; ENSP00000372303 ; ENSG00000169953 . [Q96LI6-3 ]
ENST00000382856 ; ENSP00000372307 ; ENSG00000172468 . [Q96LI6-3 ]
ENST00000624294 ; ENSP00000485201 ; ENSG00000279079 . [Q96LI6-1 ]
ENST00000624654 ; ENSP00000485278 ; ENSG00000279680 . [Q96LI6-1 ]
GeneIDi 159119.
86614.
KEGGi hsa:159119.
hsa:86614.
UCSCi uc004ftp.3. human. [Q96LI6-1 ]
uc004ftr.3. human. [Q96LI6-2 ]

Organism-specific databases

CTDi 159119.
86614.
GeneCardsi GC0YM020893.
GC0YP020708.
GeneReviewsi HSFY1.
HGNCi HGNC:18568. HSFY1.
HGNC:23950. HSFY2.
MIMi 400029. gene.
neXtProti NX_Q96LI6.
PharmGKBi PA38580.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG321106.
GeneTreei ENSGT00510000047153.
HOGENOMi HOG000112960.
HOVERGENi HBG003735.
InParanoidi Q96LI6.
OMAi RTANSCF.
OrthoDBi EOG712TWS.
PhylomeDBi Q96LI6.
TreeFami TF330401.

Miscellaneous databases

NextBioi 76198.
PROi Q96LI6.
SOURCEi Search...

Gene expression databases

Bgeei Q96LI6.
CleanExi HS_HSFY1.
HS_HSFY2.
Genevestigatori Q96LI6.

Family and domain databases

Gene3Di 1.10.10.10. 1 hit.
InterProi IPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027721. HSFY.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view ]
PANTHERi PTHR10015. PTHR10015. 1 hit.
PTHR10015:SF3. PTHR10015:SF3. 1 hit.
Pfami PF00447. HSF_DNA-bind. 1 hit.
[Graphical view ]
SMARTi SM00415. HSF. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis."
    Salata E., Tessari A., Ferlin A., Bartoloni L., Slongo M., Foresta C.
    Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Testis.
  5. "Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility."
    Shinka T., Sato Y., Chen G., Naroda T., Kinoshita K., Unemi Y., Tsuji K., Toida K., Iwamoto T., Nakahori Y.
    Biol. Reprod. 71:297-306(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiHSFY1_HUMAN
AccessioniPrimary (citable) accession number: Q96LI6
Secondary accession number(s): Q17RC0
, Q7Z4L8, Q9BZA2, Q9BZA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: December 1, 2001
Last modified: November 26, 2014
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3