Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96LI6 (HSFY1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 120. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Heat shock transcription factor, Y-linked
Alternative name(s):
Heat shock transcription factor 2-like protein
Short name=HSF2-like
Gene names
Name:HSFY1
Synonyms:HSF2L, HSFY
AND
Name:HSFY2
Synonyms:HSF2L, HSFY
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length401 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Nucleus. Cytoplasm Ref.5.

Tissue specificity

Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level). Ref.2 Ref.5

Sequence similarities

Belongs to the HSF family.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
   LigandDNA-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtranscription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionsequence-specific DNA binding

Inferred from electronic annotation. Source: InterPro

sequence-specific DNA binding transcription factor activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96LI6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96LI6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
     204-401: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96LI6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
     215-401: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 401401Heat shock transcription factor, Y-linked
PRO_0000124573

Regions

DNA binding76 – 194119 By similarity

Natural variations

Alternative sequence172 – 20332LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2.
VSP_009179
Alternative sequence173 – 21442KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3.
VSP_009180
Alternative sequence204 – 401198Missing in isoform 2.
VSP_009181
Alternative sequence215 – 401187Missing in isoform 3.
VSP_009182

Experimental info

Sequence conflict94 – 996KSISWD → SLFSWE in AAK13479. Ref.2
Sequence conflict1641K → I in AAK13479. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 1990C4D91E0BB277

FASTA40145,107
        10         20         30         40         50         60 
MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV LSQGSLLESP 

        70         80         90        100        110        120 
SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE NGTCIVINEE LFKKEILETK 

       130        140        150        160        170        180 
APYRIFQTDA IKSFVRQLNL YGFSKIQQNF QRSAFLATFL SEEKESSVLS KLKFYYNPNF 

       190        200        210        220        230        240 
KRGYPQLLVR VKRRIGVKNA SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS 

       250        260        270        280        290        300 
ASKNLNMPLT RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH 

       310        320        330        340        350        360 
MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP LVSVNEAPYR 

       370        380        390        400 
NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY N 

« Hide

Isoform 2 [UniParc].

Checksum: 2E011799F83827D4
Show »

FASTA20323,370
Isoform 3 [UniParc].

Checksum: 9DAE266BD44A25CF
Show »

FASTA21424,272

References

« Hide 'large scale' references
[1]"Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis."
Salata E., Tessari A., Ferlin A., Bartoloni L., Slongo M., Foresta C.
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Tissue: Testis.
[2]"The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes."
Skaletsky H., Kuroda-Kawaguchi T., Minx P.J., Cordum H.S., Hillier L.W., Brown L.G., Repping S., Pyntikova T., Ali J., Bieri T., Chinwalla A., Delehaunty A., Delehaunty K., Du H., Fewell G., Fulton L., Fulton R., Graves T.A. expand/collapse author list , Hou S.-F., Latrielle P., Leonard S., Mardis E., Maupin R., McPherson J., Miner T., Nash W., Nguyen C., Ozersky P., Pepin K., Rock S., Rohlfing T., Scott K., Schultz B., Strong C., Tin-Wollam A., Yang S.-P., Waterston R.H., Wilson R.K., Rozen S., Page D.C.
Nature 423:825-837(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Testis.
[5]"Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility."
Shinka T., Sato Y., Chen G., Naroda T., Kinoshita K., Unemi Y., Tsuji K., Toida K., Iwamoto T., Nakahori Y.
Biol. Reprod. 71:297-306(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_005262623.1. XM_005262566.1. [Q96LI6-3]
UniGeneHs.592255.
Hs.662281.

3D structure databases

ProteinModelPortalQ96LI6.
SMRQ96LI6. Positions 80-194.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124576. 2 interactions.
IntActQ96LI6. 1 interaction.
STRING9606.ENSP00000303599.

PTM databases

PhosphoSiteQ96LI6.

Polymorphism databases

DMDM27805481.

Proteomic databases

PaxDbQ96LI6.
PRIDEQ96LI6.

Protocols and materials databases

DNASU159119.
86614.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
GeneID159119.
86614.
KEGGhsa:159119.
hsa:86614.
UCSCuc004ftp.3. human. [Q96LI6-1]
uc004ftr.3. human. [Q96LI6-2]

Organism-specific databases

CTD159119.
86614.
GeneCardsGC0YM020893.
GC0YP020708.
GeneReviewsHSFY1.
HGNCHGNC:18568. HSFY1.
HGNC:23950. HSFY2.
MIM400029. gene.
neXtProtNX_Q96LI6.
PharmGKBPA38580.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG321106.
HOGENOMHOG000112960.
HOVERGENHBG003735.
InParanoidQ96LI6.
OMARTANSCF.
OrthoDBEOG712TWS.
PhylomeDBQ96LI6.
TreeFamTF330401.

Gene expression databases

BgeeQ96LI6.
CleanExHS_HSFY1.
HS_HSFY2.
GenevestigatorQ96LI6.

Family and domain databases

Gene3D1.10.10.10. 1 hit.
InterProIPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027721. HSFY.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF3. PTHR10015:SF3. 1 hit.
PfamPF00447. HSF_DNA-bind. 1 hit.
[Graphical view]
SMARTSM00415. HSF. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio76198.
PROQ96LI6.
SOURCESearch...

Entry information

Entry nameHSFY1_HUMAN
AccessionPrimary (citable) accession number: Q96LI6
Secondary accession number(s): Q17RC0 expand/collapse secondary AC list , Q7Z4L8, Q9BZA2, Q9BZA3
Entry history
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome Y

Human chromosome Y: entries, gene names and cross-references to MIM