Reviewed,
UniProtKB/Swiss-Prot Q96LI6 (HSFY1_HUMAN)
Last modified
December 15, 2009.
Version 77.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Heat shock transcription factor, Y-linked Alternative name(s): Heat shock transcription factor 2-like protein Short name=HSF2-like | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Complete proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 401 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | regulation of transcription, DNA-dependent Inferred from electronic annotation. Source: InterPro transcriptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | sequence-specific DNA binding Inferred from electronic annotation. Source: InterPro transcription factor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96LI6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96LI6-2) The sequence of this isoform differs from the canonical sequence as follows: 172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS 204-401: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96LI6-3) The sequence of this isoform differs from the canonical sequence as follows: 173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL 215-401: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 401 | 401 | Heat shock transcription factor, Y-linked | PRO_0000124573 | |||||
Regions | |||||||||
| DNA binding | 76 – 194 | 119 | By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 172 – 203 | 32 | LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. | VSP_009179 | |||||
| Alternative sequence | 173 – 214 | 42 | KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. | VSP_009180 | |||||
| Alternative sequence | 204 – 401 | 198 | Missing in isoform 2. | VSP_009181 | |||||
| Alternative sequence | 215 – 401 | 187 | Missing in isoform 3. | VSP_009182 | |||||
Experimental info | |||||||||
| Sequence conflict | 94 – 99 | 6 | KSISWD → SLFSWE in AAK13479. Ref.2 | ||||||
| Sequence conflict | 164 | 1 | K → I in AAK13479. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis." Salata E., Tessari A., Ferlin A., Bartoloni L., Slongo M., Foresta C. Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). Tissue: Testis. |
| [2] | "The male-specific region of the human Y chromosome is a mosaic of discrete sequence classes." Skaletsky H., Kuroda-Kawaguchi T., Minx P.J., Cordum H.S., Hillier L.W., Brown L.G., Repping S., Pyntikova T., Ali J., Bieri T., Chinwalla A., Delehaunty A., Delehaunty K., Du H., Fewell G., Fulton L., Fulton R., Graves T.A. Page D.C.Nature 423:825-837(2003) [PubMed: 12815422] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Testis. |
| [5] | "Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility." Shinka T., Sato Y., Chen G., Naroda T., Kinoshita K., Unemi Y., Tsuji K., Toida K., Iwamoto T., Nakahori Y. Biol. Reprod. 71:297-306(2004) [PubMed: 15044259] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AJ566404 mRNA. Translation: CAD98806.1. AF332226 mRNA. Translation: AAK13478.1. AF332227 mRNA. Translation: AAK13479.1. AK058182 mRNA. Translation: BAB71706.1. BC036567 mRNA. Translation: AAH36567.1. BC055414 mRNA. Translation: AAH55414.1. BC117380 mRNA. Translation: AAI17381.1. BC117382 mRNA. Translation: AAI17383.1. | |
| IPI | IPI00027534. IPI00307273. IPI00385119. |
| RefSeq | NP_001001877.1. NP_149099.2. NP_689797.1. NP_714927.1. |
| UniGene | Hs.592255 Hs.662281 |
3D structure databases | |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q96LI6. |
Proteomic databases | |
| PRIDE | Q96LI6. |
Genome annotation databases | |
| Ensembl | ENST00000304790; ENSP00000306549; ENSG00000169953; Homo sapiens. [Genome view] ENST00000307393; ENSP00000303599; ENSG00000172468; Homo sapiens. [Genome view] |
| GeneID | 159119. 86614. |
| KEGG | hsa:159119. hsa:86614. |
| UCSC | uc004ftp.1. human. uc004ftr.1. human. |
Organism-specific databases | |
| CTD | 159119. 86614. |
| GeneCards | GC0YM019281. GC0YP019167. |
| HGNC | HGNC:18568. HSFY1. HGNC:23950. HSFY2. |
| MIM | 400029. gene. |
| PharmGKB | PA38580. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | HBG125928. |
| HOVERGEN | Q96LI6. |
| InParanoid | Q96LI6. |
| OMA | LYGFRKM. |
Gene expression databases | |
| Bgee | Q96LI6. |
| CleanEx | HS_HSFY1. HS_HSFY2. |
| Genevestigator | Q96LI6. |
| GermOnline | ENSG00000169953. Homo sapiens. ENSG00000172468. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000232. HSF_DNA_bd. IPR011991. Wing_hlx_DNA_bd. [Graphical view] |
| Gene3D | G3DSA:1.10.10.10. Wing_hlx_DNA_bd. 1 hit. |
| Pfam | PF00447. HSF_DNA-bind. 1 hit. [Graphical view] |
| SMART | SM00415. HSF. 1 hit. [Graphical view] |
| PROSITE | PS00434. HSF_DOMAIN. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 87877. |
| SOURCE | Search... |
Entry information
| Entry name | HSFY1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96LI6 Secondary accession number(s): Q17RC0 Q9BZA3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome Y Human chromosome Y: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


