Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock transcription factor, Y-linked

Gene

HSFY1

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi76 – 194119By similarityAdd
BLAST

GO - Molecular functioni

  1. sequence-specific DNA binding Source: InterPro
  2. sequence-specific DNA binding transcription factor activity Source: InterPro

GO - Biological processi

  1. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock transcription factor, Y-linked
Alternative name(s):
Heat shock transcription factor 2-like protein
Short name:
HSF2-like
Gene namesi
Name:HSFY1
Synonyms:HSF2L, HSFY
AND
Name:HSFY2
Synonyms:HSF2L, HSFY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome Y

Organism-specific databases

HGNCiHGNC:18568. HSFY1.
HGNC:23950. HSFY2.

Subcellular locationi

Nucleus 1 Publication. Cytoplasm 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38580.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 401401Heat shock transcription factor, Y-linkedPRO_0000124573Add
BLAST

Proteomic databases

PaxDbiQ96LI6.
PRIDEiQ96LI6.

PTM databases

PhosphoSiteiQ96LI6.

Expressioni

Tissue specificityi

Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).2 Publications

Gene expression databases

BgeeiQ96LI6.
CleanExiHS_HSFY1.
HS_HSFY2.
GenevestigatoriQ96LI6.

Interactioni

Protein-protein interaction databases

BioGridi124576. 16 interactions.
127733. 1 interaction.
IntActiQ96LI6. 6 interactions.
STRINGi9606.ENSP00000303599.

Structurei

3D structure databases

ProteinModelPortaliQ96LI6.
SMRiQ96LI6. Positions 80-194.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HSF family.Curated

Phylogenomic databases

eggNOGiNOG321106.
GeneTreeiENSGT00510000047153.
HOGENOMiHOG000112960.
HOVERGENiHBG003735.
InParanoidiQ96LI6.
OMAiQHAILNQ.
OrthoDBiEOG712TWS.
PhylomeDBiQ96LI6.
TreeFamiTF330401.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027721. HSFY.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF3. PTHR10015:SF3. 1 hit.
PfamiPF00447. HSF_DNA-bind. 1 hit.
[Graphical view]
SMARTiSM00415. HSF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV
60 70 80 90 100
LSQGSLLESP SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE
110 120 130 140 150
NGTCIVINEE LFKKEILETK APYRIFQTDA IKSFVRQLNL YGFSKIQQNF
160 170 180 190 200
QRSAFLATFL SEEKESSVLS KLKFYYNPNF KRGYPQLLVR VKRRIGVKNA
210 220 230 240 250
SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS ASKNLNMPLT
260 270 280 290 300
RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH
310 320 330 340 350
MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP
360 370 380 390 400
LVSVNEAPYR NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY

N
Length:401
Mass (Da):45,107
Last modified:November 30, 2001 - v1
Checksum:i1990C4D91E0BB277
GO
Isoform 2 (identifier: Q96LI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
     204-401: Missing.

Note: No experimental confirmation available.

Show »
Length:203
Mass (Da):23,370
Checksum:i2E011799F83827D4
GO
Isoform 3 (identifier: Q96LI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
     215-401: Missing.

Show »
Length:214
Mass (Da):24,272
Checksum:i9DAE266BD44A25CF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti94 – 996KSISWD → SLFSWE in AAK13479 (PubMed:12815422).Curated
Sequence conflicti164 – 1641K → I in AAK13479 (PubMed:12815422).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei172 – 20332LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. 1 PublicationVSP_009179Add
BLAST
Alternative sequencei173 – 21442KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. 2 PublicationsVSP_009180Add
BLAST
Alternative sequencei204 – 401198Missing in isoform 2. 1 PublicationVSP_009181Add
BLAST
Alternative sequencei215 – 401187Missing in isoform 3. 2 PublicationsVSP_009182Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSiCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_005262623.1. XM_005262566.1. [Q96LI6-3]
UniGeneiHs.592255.
Hs.662281.

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
ENST00000624294; ENSP00000485201; ENSG00000279079. [Q96LI6-1]
ENST00000624654; ENSP00000485278; ENSG00000279680. [Q96LI6-1]
GeneIDi159119.
86614.
KEGGihsa:159119.
hsa:86614.
UCSCiuc004ftp.3. human. [Q96LI6-1]
uc004ftr.3. human. [Q96LI6-2]

Polymorphism databases

DMDMi27805481.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSiCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_005262623.1. XM_005262566.1. [Q96LI6-3]
UniGeneiHs.592255.
Hs.662281.

3D structure databases

ProteinModelPortaliQ96LI6.
SMRiQ96LI6. Positions 80-194.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124576. 16 interactions.
127733. 1 interaction.
IntActiQ96LI6. 6 interactions.
STRINGi9606.ENSP00000303599.

PTM databases

PhosphoSiteiQ96LI6.

Polymorphism databases

DMDMi27805481.

Proteomic databases

PaxDbiQ96LI6.
PRIDEiQ96LI6.

Protocols and materials databases

DNASUi159119.
86614.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
ENST00000624294; ENSP00000485201; ENSG00000279079. [Q96LI6-1]
ENST00000624654; ENSP00000485278; ENSG00000279680. [Q96LI6-1]
GeneIDi159119.
86614.
KEGGihsa:159119.
hsa:86614.
UCSCiuc004ftp.3. human. [Q96LI6-1]
uc004ftr.3. human. [Q96LI6-2]

Organism-specific databases

CTDi159119.
86614.
GeneCardsiGC0YM020893.
GC0YP020708.
GeneReviewsiHSFY1.
HGNCiHGNC:18568. HSFY1.
HGNC:23950. HSFY2.
MIMi400029. gene.
neXtProtiNX_Q96LI6.
PharmGKBiPA38580.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG321106.
GeneTreeiENSGT00510000047153.
HOGENOMiHOG000112960.
HOVERGENiHBG003735.
InParanoidiQ96LI6.
OMAiQHAILNQ.
OrthoDBiEOG712TWS.
PhylomeDBiQ96LI6.
TreeFamiTF330401.

Miscellaneous databases

NextBioi76198.
PROiQ96LI6.
SOURCEiSearch...

Gene expression databases

BgeeiQ96LI6.
CleanExiHS_HSFY1.
HS_HSFY2.
GenevestigatoriQ96LI6.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiIPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027721. HSFY.
IPR011991. WHTH_DNA-bd_dom.
[Graphical view]
PANTHERiPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF3. PTHR10015:SF3. 1 hit.
PfamiPF00447. HSF_DNA-bind. 1 hit.
[Graphical view]
SMARTiSM00415. HSF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis."
    Salata E., Tessari A., Ferlin A., Bartoloni L., Slongo M., Foresta C.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Testis.
  5. "Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility."
    Shinka T., Sato Y., Chen G., Naroda T., Kinoshita K., Unemi Y., Tsuji K., Toida K., Iwamoto T., Nakahori Y.
    Biol. Reprod. 71:297-306(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiHSFY1_HUMAN
AccessioniPrimary (citable) accession number: Q96LI6
Secondary accession number(s): Q17RC0
, Q7Z4L8, Q9BZA2, Q9BZA3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 16, 2003
Last sequence update: November 30, 2001
Last modified: February 3, 2015
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.