Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96LI6

- HSFY1_HUMAN

UniProt

Q96LI6 - HSFY1_HUMAN

Protein

Heat shock transcription factor, Y-linked

Gene

HSFY1

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi76 – 194119By similarityAdd
    BLAST

    GO - Molecular functioni

    1. sequence-specific DNA binding Source: InterPro
    2. sequence-specific DNA binding transcription factor activity Source: InterPro

    GO - Biological processi

    1. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Heat shock transcription factor, Y-linked
    Alternative name(s):
    Heat shock transcription factor 2-like protein
    Short name:
    HSF2-like
    Gene namesi
    Name:HSFY1
    Synonyms:HSF2L, HSFY
    AND
    Name:HSFY2
    Synonyms:HSF2L, HSFY
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome Y

    Organism-specific databases

    HGNCiHGNC:18568. HSFY1.
    HGNC:23950. HSFY2.

    Subcellular locationi

    Nucleus 1 Publication. Cytoplasm 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38580.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 401401Heat shock transcription factor, Y-linkedPRO_0000124573Add
    BLAST

    Proteomic databases

    PaxDbiQ96LI6.
    PRIDEiQ96LI6.

    PTM databases

    PhosphoSiteiQ96LI6.

    Expressioni

    Tissue specificityi

    Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).2 Publications

    Gene expression databases

    BgeeiQ96LI6.
    CleanExiHS_HSFY1.
    HS_HSFY2.
    GenevestigatoriQ96LI6.

    Interactioni

    Protein-protein interaction databases

    BioGridi124576. 2 interactions.
    IntActiQ96LI6. 6 interactions.
    STRINGi9606.ENSP00000303599.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96LI6.
    SMRiQ96LI6. Positions 80-194.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the HSF family.Curated

    Phylogenomic databases

    eggNOGiNOG321106.
    HOGENOMiHOG000112960.
    HOVERGENiHBG003735.
    InParanoidiQ96LI6.
    OMAiRTANSCF.
    OrthoDBiEOG712TWS.
    PhylomeDBiQ96LI6.
    TreeFamiTF330401.

    Family and domain databases

    Gene3Di1.10.10.10. 1 hit.
    InterProiIPR000232. HSF_DNA-bd.
    IPR027725. HSF_fam.
    IPR027721. HSFY.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view]
    PANTHERiPTHR10015. PTHR10015. 1 hit.
    PTHR10015:SF3. PTHR10015:SF3. 1 hit.
    PfamiPF00447. HSF_DNA-bind. 1 hit.
    [Graphical view]
    SMARTiSM00415. HSF. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96LI6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV    50
    LSQGSLLESP SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE 100
    NGTCIVINEE LFKKEILETK APYRIFQTDA IKSFVRQLNL YGFSKIQQNF 150
    QRSAFLATFL SEEKESSVLS KLKFYYNPNF KRGYPQLLVR VKRRIGVKNA 200
    SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS ASKNLNMPLT 250
    RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH 300
    MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP 350
    LVSVNEAPYR NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY 400
    N 401
    Length:401
    Mass (Da):45,107
    Last modified:December 1, 2001 - v1
    Checksum:i1990C4D91E0BB277
    GO
    Isoform 2 (identifier: Q96LI6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
         204-401: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:203
    Mass (Da):23,370
    Checksum:i2E011799F83827D4
    GO
    Isoform 3 (identifier: Q96LI6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
         215-401: Missing.

    Show »
    Length:214
    Mass (Da):24,272
    Checksum:i9DAE266BD44A25CF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti94 – 996KSISWD → SLFSWE in AAK13479. (PubMed:12815422)Curated
    Sequence conflicti164 – 1641K → I in AAK13479. (PubMed:12815422)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei172 – 20332LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. 1 PublicationVSP_009179Add
    BLAST
    Alternative sequencei173 – 21442KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. 2 PublicationsVSP_009180Add
    BLAST
    Alternative sequencei204 – 401198Missing in isoform 2. 1 PublicationVSP_009181Add
    BLAST
    Alternative sequencei215 – 401187Missing in isoform 3. 2 PublicationsVSP_009182Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ566404 mRNA. Translation: CAD98806.1.
    AF332226 mRNA. Translation: AAK13478.1.
    AF332227 mRNA. Translation: AAK13479.1.
    AK058182 mRNA. Translation: BAB71706.1.
    BC036567 mRNA. Translation: AAH36567.1.
    BC055414 mRNA. Translation: AAH55414.1.
    BC117380 mRNA. Translation: AAI17381.1.
    BC117382 mRNA. Translation: AAI17383.1.
    CCDSiCCDS14790.1. [Q96LI6-2]
    CCDS14791.1. [Q96LI6-1]
    CCDS35475.1. [Q96LI6-1]
    CCDS35476.1. [Q96LI6-2]
    RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
    NP_149099.2. NM_033108.2. [Q96LI6-1]
    NP_689797.1. NM_152584.1. [Q96LI6-2]
    NP_714927.1. NM_153716.1. [Q96LI6-1]
    XP_005262623.1. XM_005262566.1. [Q96LI6-3]
    UniGeneiHs.592255.
    Hs.662281.

    Genome annotation databases

    EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
    ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
    ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
    ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
    ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
    ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
    ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
    GeneIDi159119.
    86614.
    KEGGihsa:159119.
    hsa:86614.
    UCSCiuc004ftp.3. human. [Q96LI6-1]
    uc004ftr.3. human. [Q96LI6-2]

    Polymorphism databases

    DMDMi27805481.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ566404 mRNA. Translation: CAD98806.1 .
    AF332226 mRNA. Translation: AAK13478.1 .
    AF332227 mRNA. Translation: AAK13479.1 .
    AK058182 mRNA. Translation: BAB71706.1 .
    BC036567 mRNA. Translation: AAH36567.1 .
    BC055414 mRNA. Translation: AAH55414.1 .
    BC117380 mRNA. Translation: AAI17381.1 .
    BC117382 mRNA. Translation: AAI17383.1 .
    CCDSi CCDS14790.1. [Q96LI6-2 ]
    CCDS14791.1. [Q96LI6-1 ]
    CCDS35475.1. [Q96LI6-1 ]
    CCDS35476.1. [Q96LI6-2 ]
    RefSeqi NP_001001877.1. NM_001001877.1. [Q96LI6-2 ]
    NP_149099.2. NM_033108.2. [Q96LI6-1 ]
    NP_689797.1. NM_152584.1. [Q96LI6-2 ]
    NP_714927.1. NM_153716.1. [Q96LI6-1 ]
    XP_005262623.1. XM_005262566.1. [Q96LI6-3 ]
    UniGenei Hs.592255.
    Hs.662281.

    3D structure databases

    ProteinModelPortali Q96LI6.
    SMRi Q96LI6. Positions 80-194.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124576. 2 interactions.
    IntActi Q96LI6. 6 interactions.
    STRINGi 9606.ENSP00000303599.

    PTM databases

    PhosphoSitei Q96LI6.

    Polymorphism databases

    DMDMi 27805481.

    Proteomic databases

    PaxDbi Q96LI6.
    PRIDEi Q96LI6.

    Protocols and materials databases

    DNASUi 159119.
    86614.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000304790 ; ENSP00000306549 ; ENSG00000169953 . [Q96LI6-1 ]
    ENST00000307393 ; ENSP00000303599 ; ENSG00000172468 . [Q96LI6-1 ]
    ENST00000309834 ; ENSP00000311166 ; ENSG00000172468 . [Q96LI6-2 ]
    ENST00000338876 ; ENSP00000342302 ; ENSG00000172468 . [Q96LI6-3 ]
    ENST00000344884 ; ENSP00000340971 ; ENSG00000169953 . [Q96LI6-2 ]
    ENST00000382852 ; ENSP00000372303 ; ENSG00000169953 . [Q96LI6-3 ]
    ENST00000382856 ; ENSP00000372307 ; ENSG00000172468 . [Q96LI6-3 ]
    GeneIDi 159119.
    86614.
    KEGGi hsa:159119.
    hsa:86614.
    UCSCi uc004ftp.3. human. [Q96LI6-1 ]
    uc004ftr.3. human. [Q96LI6-2 ]

    Organism-specific databases

    CTDi 159119.
    86614.
    GeneCardsi GC0YM020893.
    GC0YP020708.
    GeneReviewsi HSFY1.
    HGNCi HGNC:18568. HSFY1.
    HGNC:23950. HSFY2.
    MIMi 400029. gene.
    neXtProti NX_Q96LI6.
    PharmGKBi PA38580.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG321106.
    HOGENOMi HOG000112960.
    HOVERGENi HBG003735.
    InParanoidi Q96LI6.
    OMAi RTANSCF.
    OrthoDBi EOG712TWS.
    PhylomeDBi Q96LI6.
    TreeFami TF330401.

    Miscellaneous databases

    NextBioi 76198.
    PROi Q96LI6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q96LI6.
    CleanExi HS_HSFY1.
    HS_HSFY2.
    Genevestigatori Q96LI6.

    Family and domain databases

    Gene3Di 1.10.10.10. 1 hit.
    InterProi IPR000232. HSF_DNA-bd.
    IPR027725. HSF_fam.
    IPR027721. HSFY.
    IPR011991. WHTH_DNA-bd_dom.
    [Graphical view ]
    PANTHERi PTHR10015. PTHR10015. 1 hit.
    PTHR10015:SF3. PTHR10015:SF3. 1 hit.
    Pfami PF00447. HSF_DNA-bind. 1 hit.
    [Graphical view ]
    SMARTi SM00415. HSF. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis."
      Salata E., Tessari A., Ferlin A., Bartoloni L., Slongo M., Foresta C.
      Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Testis.
    5. "Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility."
      Shinka T., Sato Y., Chen G., Naroda T., Kinoshita K., Unemi Y., Tsuji K., Toida K., Iwamoto T., Nakahori Y.
      Biol. Reprod. 71:297-306(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiHSFY1_HUMAN
    AccessioniPrimary (citable) accession number: Q96LI6
    Secondary accession number(s): Q17RC0
    , Q7Z4L8, Q9BZA2, Q9BZA3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 17, 2003
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 121 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome Y
      Human chromosome Y: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3