Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Heat shock transcription factor, Y-linked

Gene

HSFY1

more
Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi76 – 194By similarityAdd BLAST119

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Heat shock transcription factor, Y-linked
Alternative name(s):
Heat shock transcription factor 2-like protein
Short name:
HSF2-like
Gene namesi
Name:HSFY1
Synonyms:HSF2L, HSFY
AND
Name:HSFY2
Synonyms:HSF2L, HSFY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome Y

Organism-specific databases

HGNCiHGNC:18568. HSFY1.
HGNC:23950. HSFY2.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi159119.
86614.
OpenTargetsiENSG00000169953.
PharmGKBiPA38580.

Polymorphism and mutation databases

DMDMi27805481.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001245731 – 401Heat shock transcription factor, Y-linkedAdd BLAST401

Proteomic databases

EPDiQ96LI6.
PaxDbiQ96LI6.
PeptideAtlasiQ96LI6.
PRIDEiQ96LI6.

PTM databases

iPTMnetiQ96LI6.
PhosphoSitePlusiQ96LI6.

Expressioni

Tissue specificityi

Testis-specific. Present in Sertoli cells and spermatogenic cells (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000169953.
CleanExiHS_HSFY1.
HS_HSFY2.
GenevisibleiQ96LI6. HS.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124576. 22 interactors.
127733. 1 interactor.
IntActiQ96LI6. 23 interactors.
STRINGi9606.ENSP00000306549.

Structurei

3D structure databases

ProteinModelPortaliQ96LI6.
SMRiQ96LI6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the HSF family.Curated

Phylogenomic databases

eggNOGiKOG0627. Eukaryota.
COG5169. LUCA.
GeneTreeiENSGT00510000047153.
HOGENOMiHOG000112960.
HOVERGENiHBG003735.
InParanoidiQ96LI6.
OMAiHFRAGAN.
OrthoDBiEOG091G0A49.
PhylomeDBiQ96LI6.
TreeFamiTF330401.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiView protein in InterPro
IPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027730. HSFX/HSFY.
IPR011991. WHTH_DNA-bd_dom.
PANTHERiPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF249. PTHR10015:SF249. 1 hit.
PfamiView protein in Pfam
PF00447. HSF_DNA-bind. 1 hit.
SMARTiView protein in SMART
SM00415. HSF. 1 hit.
SUPFAMiSSF46785. SSF46785. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LI6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHVSSETQD VSPKDELTAS EASTRSPLCE HTFPGDSDLR SMIEEHAFQV
60 70 80 90 100
LSQGSLLESP SYTVCVSEPD KDDDFLSLNF PRKLWKIVES DQFKSISWDE
110 120 130 140 150
NGTCIVINEE LFKKEILETK APYRIFQTDA IKSFVRQLNL YGFSKIQQNF
160 170 180 190 200
QRSAFLATFL SEEKESSVLS KLKFYYNPNF KRGYPQLLVR VKRRIGVKNA
210 220 230 240 250
SPISTLFNED FNKKHFRAGA NMENHNSALA AEASEESLFS ASKNLNMPLT
260 270 280 290 300
RESSVRQIIA NSSVPIRSGF PPPSPSTSVG PSEQIATDQH AILNQLTTIH
310 320 330 340 350
MHSHSTYMQA RGHIVNFITT TTSQYHIISP LQNGYFGLTV EPSAVPTRYP
360 370 380 390 400
LVSVNEAPYR NMLPAGNPWL QMPTIADRSA APHSRLALQP SPLDKYHPNY

N
Length:401
Mass (Da):45,107
Last modified:December 1, 2001 - v1
Checksum:i1990C4D91E0BB277
GO
Isoform 2 (identifier: Q96LI6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-203: LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI → IRFTKMKLSRSSTYENRYLCCNLHLKDESNYS
     204-401: Missing.

Note: No experimental confirmation available.
Show »
Length:203
Mass (Da):23,370
Checksum:i2E011799F83827D4
GO
Isoform 3 (identifier: Q96LI6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-214: KFYYNPNFKR...TLFNEDFNKK → HVFVFHHSLF...STWSGDSWLL
     215-401: Missing.

Show »
Length:214
Mass (Da):24,272
Checksum:i9DAE266BD44A25CF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti94 – 99KSISWD → SLFSWE in AAK13479 (PubMed:12815422).Curated6
Sequence conflicti164K → I in AAK13479 (PubMed:12815422).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_009179172 – 203LKFYY…NASPI → IRFTKMKLSRSSTYENRYLC CNLHLKDESNYS in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_009180173 – 214KFYYN…DFNKK → HVFVFHHSLFGATFGEHHFQ PCPLPSGNKAPISTWSGDSW LL in isoform 3. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_009181204 – 401Missing in isoform 2. 1 PublicationAdd BLAST198
Alternative sequenceiVSP_009182215 – 401Missing in isoform 3. 2 PublicationsAdd BLAST187

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSiCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_016885520.1. XM_017030031.1. [Q96LI6-3]
UniGeneiHs.567744.
Hs.592255.
Hs.662281.

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
GeneIDi159119.
86614.
KEGGihsa:159119.
hsa:86614.
UCSCiuc004ftp.3. human. [Q96LI6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ566404 mRNA. Translation: CAD98806.1.
AF332226 mRNA. Translation: AAK13478.1.
AF332227 mRNA. Translation: AAK13479.1.
AK058182 mRNA. Translation: BAB71706.1.
BC036567 mRNA. Translation: AAH36567.1.
BC055414 mRNA. Translation: AAH55414.1.
BC117380 mRNA. Translation: AAI17381.1.
BC117382 mRNA. Translation: AAI17383.1.
CCDSiCCDS14790.1. [Q96LI6-2]
CCDS14791.1. [Q96LI6-1]
CCDS35475.1. [Q96LI6-1]
CCDS35476.1. [Q96LI6-2]
RefSeqiNP_001001877.1. NM_001001877.1. [Q96LI6-2]
NP_149099.2. NM_033108.2. [Q96LI6-1]
NP_689797.1. NM_152584.1. [Q96LI6-2]
NP_714927.1. NM_153716.1. [Q96LI6-1]
XP_016885520.1. XM_017030031.1. [Q96LI6-3]
UniGeneiHs.567744.
Hs.592255.
Hs.662281.

3D structure databases

ProteinModelPortaliQ96LI6.
SMRiQ96LI6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124576. 22 interactors.
127733. 1 interactor.
IntActiQ96LI6. 23 interactors.
STRINGi9606.ENSP00000306549.

PTM databases

iPTMnetiQ96LI6.
PhosphoSitePlusiQ96LI6.

Polymorphism and mutation databases

DMDMi27805481.

Proteomic databases

EPDiQ96LI6.
PaxDbiQ96LI6.
PeptideAtlasiQ96LI6.
PRIDEiQ96LI6.

Protocols and materials databases

DNASUi159119.
86614.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000304790; ENSP00000306549; ENSG00000169953. [Q96LI6-1]
ENST00000307393; ENSP00000303599; ENSG00000172468. [Q96LI6-1]
ENST00000309834; ENSP00000311166; ENSG00000172468. [Q96LI6-2]
ENST00000338876; ENSP00000342302; ENSG00000172468. [Q96LI6-3]
ENST00000344884; ENSP00000340971; ENSG00000169953. [Q96LI6-2]
ENST00000382852; ENSP00000372303; ENSG00000169953. [Q96LI6-3]
ENST00000382856; ENSP00000372307; ENSG00000172468. [Q96LI6-3]
GeneIDi159119.
86614.
KEGGihsa:159119.
hsa:86614.
UCSCiuc004ftp.3. human. [Q96LI6-1]

Organism-specific databases

CTDi159119.
86614.
DisGeNETi159119.
86614.
GeneCardsiHSFY1.
HSFY2.
GeneReviewsiHSFY1.
HGNCiHGNC:18568. HSFY1.
HGNC:23950. HSFY2.
MIMi400029. gene.
neXtProtiNX_Q96LI6.
OpenTargetsiENSG00000169953.
PharmGKBiPA38580.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0627. Eukaryota.
COG5169. LUCA.
GeneTreeiENSGT00510000047153.
HOGENOMiHOG000112960.
HOVERGENiHBG003735.
InParanoidiQ96LI6.
OMAiHFRAGAN.
OrthoDBiEOG091G0A49.
PhylomeDBiQ96LI6.
TreeFamiTF330401.

Miscellaneous databases

PROiQ96LI6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000169953.
CleanExiHS_HSFY1.
HS_HSFY2.
GenevisibleiQ96LI6. HS.

Family and domain databases

Gene3Di1.10.10.10. 1 hit.
InterProiView protein in InterPro
IPR000232. HSF_DNA-bd.
IPR027725. HSF_fam.
IPR027730. HSFX/HSFY.
IPR011991. WHTH_DNA-bd_dom.
PANTHERiPTHR10015. PTHR10015. 1 hit.
PTHR10015:SF249. PTHR10015:SF249. 1 hit.
PfamiView protein in Pfam
PF00447. HSF_DNA-bind. 1 hit.
SMARTiView protein in SMART
SM00415. HSF. 1 hit.
SUPFAMiSSF46785. SSF46785. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiHSFY1_HUMAN
AccessioniPrimary (citable) accession number: Q96LI6
Secondary accession number(s): Q17RC0
, Q7Z4L8, Q9BZA2, Q9BZA3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: December 1, 2001
Last modified: March 15, 2017
This is version 143 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.