Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bcl-2-modifying factor

Gene

BMF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in apoptosis. Isoform 1 seems to be the main initiator.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis

Enzyme and pathway databases

ReactomeiR-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-139910. Activation of BMF and translocation to mitochondria.
SIGNORiQ96LC9.

Names & Taxonomyi

Protein namesi
Recommended name:
Bcl-2-modifying factor
Gene namesi
Name:BMF
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:24132. BMF.

Subcellular locationi

GO - Cellular componenti

  • acrosomal vesicle Source: Ensembl
  • cytosol Source: Reactome
  • mitochondrial outer membrane Source: Reactome
  • myosin complex Source: UniProtKB
  • plasma membrane Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134893658.

Polymorphism and mutation databases

BioMutaiBMF.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 184184Bcl-2-modifying factorPRO_0000143111Add
BLAST

Proteomic databases

PaxDbiQ96LC9.
PRIDEiQ96LC9.

PTM databases

iPTMnetiQ96LC9.
PhosphoSiteiQ96LC9.

Expressioni

Tissue specificityi

Isoform 1 is mainly expressed in B-lymphoid cells. Isoform 2 and isoform 3 are mainly expressed in B-CLL and normal B-cells.1 Publication

Gene expression databases

BgeeiQ96LC9.
CleanExiHS_BMF.
ExpressionAtlasiQ96LC9. baseline and differential.
GenevisibleiQ96LC9. HS.

Organism-specific databases

HPAiHPA010120.

Interactioni

Subunit structurei

Interacts with MCL1, BCL2, BCL2L1/BCL-Xl, BCL2A1 and BCL2L2/BCL-w. Interacts with the myosin V actin motor complex through its binding to DLC2 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
BCL2L1Q078173EBI-3919268,EBI-78035
BCL2L2Q928435EBI-3919268,EBI-707714
DYNLL2Q96FJ23EBI-3919268,EBI-742371
RELQ048643EBI-3919268,EBI-307352
SEC14L4Q9UDX33EBI-3919268,EBI-10320311
TFIP11Q9UBB93EBI-3919268,EBI-1105213

Protein-protein interaction databases

BioGridi124716. 16 interactions.
IntActiQ96LC9. 10 interactions.
STRINGi9606.ENSP00000346697.

Structurei

3D structure databases

ProteinModelPortaliQ96LC9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni67 – 759Interaction with DLC2By similarity

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi133 – 14715BH3Add
BLAST

Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Phylogenomic databases

eggNOGiENOG410IHFT. Eukaryota.
ENOG410YIXY. LUCA.
GeneTreeiENSGT00390000017896.
HOVERGENiHBG050697.
InParanoidiQ96LC9.
KOiK17460.
OMAiFHRLHMQ.
OrthoDBiEOG7QRQW6.
PhylomeDBiQ96LC9.
TreeFamiTF336039.

Family and domain databases

InterProiIPR028192. BMF.
[Graphical view]
PANTHERiPTHR32014. PTHR32014. 1 hit.
PfamiPF15185. BMF. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LC9-1) [UniParc]FASTAAdd to basket

Also known as: BMF-I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPSQCVEEL EDDVFQPEDG EPVTQPGSLL SADLFAQSLL DCPLSRLQLF
60 70 80 90 100
PLTHCCGPGL RPTSQEDKAT QTLSPASPSQ GVMLPCGVTE EPQRLFYGNA
110 120 130 140 150
GYRLPLPASF PAVLPIGEQP PEGQWQHQAE VQIARKLQCI ADQFHRLHVQ
160 170 180
QHQQNQNRVW WQILLFLHNL ALNGEENRNG AGPR
Length:184
Mass (Da):20,508
Last modified:December 1, 2001 - v1
Checksum:i21479B25CC727853
GO
Isoform 2 (identifier: Q96LC9-2) [UniParc]FASTAAdd to basket

Also known as: BMF-II

The sequence of this isoform differs from the canonical sequence as follows:
     131-151: Missing.

Show »
Length:163
Mass (Da):17,994
Checksum:i842BA90CD323E4A3
GO
Isoform 3 (identifier: Q96LC9-3) [UniParc]FASTAAdd to basket

Also known as: BMF-III

The sequence of this isoform differs from the canonical sequence as follows:
     98-129: GNAGYRLPLPASFPAVLPIGEQPPEGQWQHQA → APAEPKSCVVADPPLPAQPCFEWRREQERGRP
     130-184: Missing.

Show »
Length:129
Mass (Da):14,150
Checksum:i4147FE8EB6E14B25
GO

Sequence cautioni

The sequence AAH60783.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB15762.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti61 – 611R → Q in AAH69328 (PubMed:15489334).Curated
Sequence conflicti80 – 801Q → P in AAH69505 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei98 – 12932GNAGY…WQHQA → APAEPKSCVVADPPLPAQPC FEWRREQERGRP in isoform 3. 1 PublicationVSP_012293Add
BLAST
Alternative sequencei130 – 18455Missing in isoform 3. 1 PublicationVSP_012294Add
BLAST
Alternative sequencei131 – 15121Missing in isoform 2. 1 PublicationVSP_012292Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029254 mRNA. Translation: AAK38748.1.
AY222040 mRNA. Translation: AAP22965.1.
AY222041 mRNA. Translation: AAP22966.1.
AK024472 mRNA. Translation: BAB15762.1. Different initiation.
BC060783 mRNA. Translation: AAH60783.1. Different initiation.
BC069328 mRNA. Translation: AAH69328.1.
BC069505 mRNA. Translation: AAH69505.1.
BC070043 mRNA. Translation: AAH70043.2.
BC104983 mRNA. Translation: AAI04984.1.
BC104985 mRNA. Translation: AAI04986.1.
CCDSiCCDS10052.1. [Q96LC9-1]
CCDS32196.1. [Q96LC9-3]
CCDS45223.1. [Q96LC9-2]
RefSeqiNP_001003940.1. NM_001003940.1. [Q96LC9-1]
NP_001003942.1. NM_001003942.1. [Q96LC9-2]
NP_001003943.1. NM_001003943.2. [Q96LC9-3]
NP_277038.1. NM_033503.3. [Q96LC9-1]
XP_005254817.1. XM_005254760.3. [Q96LC9-1]
XP_005254818.1. XM_005254761.3. [Q96LC9-1]
XP_006720796.1. XM_006720733.1. [Q96LC9-1]
XP_006720797.1. XM_006720734.1. [Q96LC9-1]
UniGeneiHs.591104.

Genome annotation databases

EnsembliENST00000354670; ENSP00000346697; ENSG00000104081. [Q96LC9-1]
ENST00000397573; ENSP00000380703; ENSG00000104081. [Q96LC9-1]
ENST00000431415; ENSP00000396511; ENSG00000104081. [Q96LC9-2]
ENST00000558774; ENSP00000453913; ENSG00000104081. [Q96LC9-3]
ENST00000559701; ENSP00000453919; ENSG00000104081. [Q96LC9-3]
ENST00000561282; ENSP00000453522; ENSG00000104081. [Q96LC9-1]
ENST00000561360; ENSP00000453892; ENSG00000104081. [Q96LC9-1]
GeneIDi90427.
KEGGihsa:90427.
UCSCiuc001zkt.6. human. [Q96LC9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029254 mRNA. Translation: AAK38748.1.
AY222040 mRNA. Translation: AAP22965.1.
AY222041 mRNA. Translation: AAP22966.1.
AK024472 mRNA. Translation: BAB15762.1. Different initiation.
BC060783 mRNA. Translation: AAH60783.1. Different initiation.
BC069328 mRNA. Translation: AAH69328.1.
BC069505 mRNA. Translation: AAH69505.1.
BC070043 mRNA. Translation: AAH70043.2.
BC104983 mRNA. Translation: AAI04984.1.
BC104985 mRNA. Translation: AAI04986.1.
CCDSiCCDS10052.1. [Q96LC9-1]
CCDS32196.1. [Q96LC9-3]
CCDS45223.1. [Q96LC9-2]
RefSeqiNP_001003940.1. NM_001003940.1. [Q96LC9-1]
NP_001003942.1. NM_001003942.1. [Q96LC9-2]
NP_001003943.1. NM_001003943.2. [Q96LC9-3]
NP_277038.1. NM_033503.3. [Q96LC9-1]
XP_005254817.1. XM_005254760.3. [Q96LC9-1]
XP_005254818.1. XM_005254761.3. [Q96LC9-1]
XP_006720796.1. XM_006720733.1. [Q96LC9-1]
XP_006720797.1. XM_006720734.1. [Q96LC9-1]
UniGeneiHs.591104.

3D structure databases

ProteinModelPortaliQ96LC9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124716. 16 interactions.
IntActiQ96LC9. 10 interactions.
STRINGi9606.ENSP00000346697.

PTM databases

iPTMnetiQ96LC9.
PhosphoSiteiQ96LC9.

Polymorphism and mutation databases

BioMutaiBMF.

Proteomic databases

PaxDbiQ96LC9.
PRIDEiQ96LC9.

Protocols and materials databases

DNASUi90427.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354670; ENSP00000346697; ENSG00000104081. [Q96LC9-1]
ENST00000397573; ENSP00000380703; ENSG00000104081. [Q96LC9-1]
ENST00000431415; ENSP00000396511; ENSG00000104081. [Q96LC9-2]
ENST00000558774; ENSP00000453913; ENSG00000104081. [Q96LC9-3]
ENST00000559701; ENSP00000453919; ENSG00000104081. [Q96LC9-3]
ENST00000561282; ENSP00000453522; ENSG00000104081. [Q96LC9-1]
ENST00000561360; ENSP00000453892; ENSG00000104081. [Q96LC9-1]
GeneIDi90427.
KEGGihsa:90427.
UCSCiuc001zkt.6. human. [Q96LC9-1]

Organism-specific databases

CTDi90427.
GeneCardsiBMF.
HGNCiHGNC:24132. BMF.
HPAiHPA010120.
MIMi606266. gene.
neXtProtiNX_Q96LC9.
PharmGKBiPA134893658.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHFT. Eukaryota.
ENOG410YIXY. LUCA.
GeneTreeiENSGT00390000017896.
HOVERGENiHBG050697.
InParanoidiQ96LC9.
KOiK17460.
OMAiFHRLHMQ.
OrthoDBiEOG7QRQW6.
PhylomeDBiQ96LC9.
TreeFamiTF336039.

Enzyme and pathway databases

ReactomeiR-HSA-111453. BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members.
R-HSA-139910. Activation of BMF and translocation to mitochondria.
SIGNORiQ96LC9.

Miscellaneous databases

GeneWikiiBMF_(gene).
GenomeRNAii90427.
PROiQ96LC9.
SOURCEiSearch...

Gene expression databases

BgeeiQ96LC9.
CleanExiHS_BMF.
ExpressionAtlasiQ96LC9. baseline and differential.
GenevisibleiQ96LC9. HS.

Family and domain databases

InterProiIPR028192. BMF.
[Graphical view]
PANTHERiPTHR32014. PTHR32014. 1 hit.
PfamiPF15185. BMF. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis."
    Puthalakath H., Villunger A., O'Reilly L.A., Beaumont J.G., Coultas L., Cheney R.E., Huang D.C.S., Strasser A.
    Science 293:1829-1832(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: T-cell.
  2. "Expression and transcriptional regulation of functionally distinct Bmf isoforms in B-chronic lymphocytic leukemia cells."
    Morales A.A., Olsson A., Celsing F., Oesterborg A., Jondal M., Osorio L.M.
    Leukemia 18:41-47(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY.
    Tissue: B-cell.
  3. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Spleen.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.

Entry informationi

Entry nameiBMF_HUMAN
AccessioniPrimary (citable) accession number: Q96LC9
Secondary accession number(s): Q2M396
, Q6NT30, Q6NT56, Q6P9F6, Q7Z7D4, Q7Z7D5, Q9H7K7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: December 1, 2001
Last modified: June 8, 2016
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.