Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Fc receptor-like protein 1

Gene

FCRL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation.1 Publication

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Fc receptor-like protein 1
Short name:
FcR-like protein 1
Short name:
FcRL1
Alternative name(s):
Fc receptor homolog 1
Short name:
FcRH1
IFGP family protein 1
Short name:
hIFGP1
Immune receptor translocation-associated protein 5
CD_antigen: CD307a
Gene namesi
Name:FCRL1
Synonyms:FCRH1, IFGP1, IRTA5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:18509. FCRL1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini17 – 307ExtracellularSequence analysisAdd BLAST291
Transmembranei308 – 328HelicalSequence analysisAdd BLAST21
Topological domaini329 – 429CytoplasmicSequence analysisAdd BLAST101

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi115350.
OpenTargetsiENSG00000163534.
PharmGKBiPA142671766.

Polymorphism and mutation databases

BioMutaiFCRL1.
DMDMi74760931.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 16Sequence analysisAdd BLAST16
ChainiPRO_000033163817 – 429Fc receptor-like protein 1Add BLAST413

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi38 ↔ 86PROSITE-ProRule annotation
Disulfide bondi134 ↔ 183PROSITE-ProRule annotation
Disulfide bondi229 ↔ 276PROSITE-ProRule annotation
Glycosylationi293N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

Phosphorylated on tyrosines upon activation.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ96LA6.
PeptideAtlasiQ96LA6.
PRIDEiQ96LA6.

PTM databases

iPTMnetiQ96LA6.
PhosphoSitePlusiQ96LA6.

Expressioni

Tissue specificityi

Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).4 Publications

Inductioni

Down-regulated in activated B-cells.1 Publication

Gene expression databases

BgeeiENSG00000163534.
CleanExiHS_FCRL1.
GenevisibleiQ96LA6. HS.

Organism-specific databases

HPAiHPA013323.

Interactioni

Protein-protein interaction databases

BioGridi125427. 1 interactor.
STRINGi9606.ENSP00000357158.

Structurei

3D structure databases

ProteinModelPortaliQ96LA6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 104Ig-like C2-type 1Add BLAST88
Domaini109 – 200Ig-like C2-type 2Add BLAST92
Domaini208 – 291Ig-like C2-type 3Add BLAST84

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi354 – 359ITIM motif 16
Motifi367 – 372ITIM motif 26
Motifi379 – 384ITIM motif 36
Motifi410 – 415ITIM motif 46
Motifi423 – 428ITIM motif 56

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J91H. Eukaryota.
ENOG411153C. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000036945.
HOVERGENiHBG074073.
InParanoidiQ96LA6.
KOiK06727.
OMAiQFQFCFF.
OrthoDBiEOG091G03OP.
PhylomeDBiQ96LA6.
TreeFamiTF351107.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96LA6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF
60 70 80 90 100
QFCFFRDTRA LGPGWSSSPK LQIAAMWKED TGSYWCEAQT MASKVLRSRR
110 120 130 140 150
SQINVHRVPV ADVSLETQPP GGQVMEGDRL VLICSVAMGT GDITFLWYKG
160 170 180 190 200
AVGLNLQSKT QRSLTAEYEI PSVRESDAEQ YYCVAENGYG PSPSGLVSIT
210 220 230 240 250
VRIPVSRPIL MLRAPRAQAA VEDVLELHCE ALRGSPPILY WFYHEDITLG
260 270 280 290 300
SRSAPSGGGA SFNLSLTEEH SGNYSCEANN GLGAQRSEAV TLNFTVPTGA
310 320 330 340 350
RSNHLTSGVI EGLLSTLGPA TVALLFCYGL KRKIGRRSAR DPLRSLPSPL
360 370 380 390 400
PQEFTYLNSP TPGQLQPIYE NVNVVSGDEV YSLAYYNQPE QESVAAETLG
410 420
THMEDKVSLD IYSRLRKANI TDVDYEDAM
Length:429
Mass (Da):46,936
Last modified:December 1, 2001 - v1
Checksum:iF6BB19942C9C7C06
GO
Isoform 2 (identifier: Q96LA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-395: Missing.

Show »
Length:428
Mass (Da):46,865
Checksum:iF20BA3110BBC7828
GO
Isoform 3 (identifier: Q96LA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-334: Missing.
     372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP

Show »
Length:366
Mass (Da):40,435
Checksum:i6F79D0F9EBDE2AE0
GO
Isoform 4 (identifier: Q96LA6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG
     239-429: Missing.

Note: No experimental confirmation available.
Show »
Length:199
Mass (Da):22,068
Checksum:iB64B24B45F3C19B2
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_042923124V → M.Corresponds to variant rs12078586dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0332901 – 39Missing in isoform 4. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_033291203 – 238IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_033292239 – 429Missing in isoform 4. 1 PublicationAdd BLAST191
Alternative sequenceiVSP_033293296 – 334Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_033294372 – 429VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_033295395Missing in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY043464 mRNA. Translation: AAK91777.1.
AF329488 mRNA. Translation: AAL23898.1.
EF064734 Genomic DNA. Translation: ABK41917.1.
AK096690 mRNA. Translation: BAC04842.1.
AK315748 mRNA. Translation: BAG38102.1.
AL833970 mRNA. Translation: CAD38815.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70232.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70233.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70234.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73052.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73053.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73054.1.
CH471121 Genomic DNA. Translation: EAW52861.1.
CH471121 Genomic DNA. Translation: EAW52862.1.
BC033690 mRNA. Translation: AAH33690.1.
CCDSiCCDS1170.1. [Q96LA6-1]
CCDS53382.1. [Q96LA6-3]
CCDS53383.1. [Q96LA6-2]
RefSeqiNP_001152869.1. NM_001159397.1. [Q96LA6-3]
NP_001152870.1. NM_001159398.1. [Q96LA6-2]
NP_443170.1. NM_052938.4. [Q96LA6-1]
UniGeneiHs.656112.

Genome annotation databases

EnsembliENST00000358292; ENSP00000351039; ENSG00000163534. [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534. [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534. [Q96LA6-2]
GeneIDi115350.
KEGGihsa:115350.
UCSCiuc001frg.4. human. [Q96LA6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY043464 mRNA. Translation: AAK91777.1.
AF329488 mRNA. Translation: AAL23898.1.
EF064734 Genomic DNA. Translation: ABK41917.1.
AK096690 mRNA. Translation: BAC04842.1.
AK315748 mRNA. Translation: BAG38102.1.
AL833970 mRNA. Translation: CAD38815.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70232.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70233.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70234.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73052.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73053.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73054.1.
CH471121 Genomic DNA. Translation: EAW52861.1.
CH471121 Genomic DNA. Translation: EAW52862.1.
BC033690 mRNA. Translation: AAH33690.1.
CCDSiCCDS1170.1. [Q96LA6-1]
CCDS53382.1. [Q96LA6-3]
CCDS53383.1. [Q96LA6-2]
RefSeqiNP_001152869.1. NM_001159397.1. [Q96LA6-3]
NP_001152870.1. NM_001159398.1. [Q96LA6-2]
NP_443170.1. NM_052938.4. [Q96LA6-1]
UniGeneiHs.656112.

3D structure databases

ProteinModelPortaliQ96LA6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125427. 1 interactor.
STRINGi9606.ENSP00000357158.

PTM databases

iPTMnetiQ96LA6.
PhosphoSitePlusiQ96LA6.

Polymorphism and mutation databases

BioMutaiFCRL1.
DMDMi74760931.

Proteomic databases

PaxDbiQ96LA6.
PeptideAtlasiQ96LA6.
PRIDEiQ96LA6.

Protocols and materials databases

DNASUi115350.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358292; ENSP00000351039; ENSG00000163534. [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534. [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534. [Q96LA6-2]
GeneIDi115350.
KEGGihsa:115350.
UCSCiuc001frg.4. human. [Q96LA6-1]

Organism-specific databases

CTDi115350.
DisGeNETi115350.
GeneCardsiFCRL1.
HGNCiHGNC:18509. FCRL1.
HPAiHPA013323.
MIMi606508. gene.
neXtProtiNX_Q96LA6.
OpenTargetsiENSG00000163534.
PharmGKBiPA142671766.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J91H. Eukaryota.
ENOG411153C. LUCA.
GeneTreeiENSGT00760000119130.
HOGENOMiHOG000036945.
HOVERGENiHBG074073.
InParanoidiQ96LA6.
KOiK06727.
OMAiQFQFCFF.
OrthoDBiEOG091G03OP.
PhylomeDBiQ96LA6.
TreeFamiTF351107.

Miscellaneous databases

ChiTaRSiFCRL1. human.
GeneWikiiFCRL1.
GenomeRNAii115350.
PROiQ96LA6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163534.
CleanExiHS_FCRL1.
GenevisibleiQ96LA6. HS.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
[Graphical view]
PfamiPF13895. Ig_2. 2 hits.
[Graphical view]
SMARTiSM00409. IG. 3 hits.
SM00408. IGc2. 3 hits.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 3 hits.
PROSITEiPS50835. IG_LIKE. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiFCRL1_HUMAN
AccessioniPrimary (citable) accession number: Q96LA6
Secondary accession number(s): B2RE05
, Q8N759, Q8NDI0, Q96PJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 138 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.