Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96LA6 (FCRL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 116. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Fc receptor-like protein 1

Short name=FcR-like protein 1
Short name=FcRL1
Alternative name(s):
Fc receptor homolog 1
Short name=FcRH1
IFGP family protein 1
Short name=hIFGP1
Immune receptor translocation-associated protein 5
CD_antigen=CD307a
Gene names
Name:FCRL1
Synonyms:FCRH1, IFGP1, IRTA5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length429 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation. Ref.10

Subcellular location

Cell membrane; Single-pass type I membrane protein Ref.10 Ref.11.

Tissue specificity

Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level). Ref.1 Ref.9 Ref.10 Ref.11

Induction

Down-regulated in activated B-cells. Ref.10

Post-translational modification

Phosphorylated on tyrosines upon activation. Ref.10

Sequence similarities

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Ontologies

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96LA6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96LA6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     395-395: Missing.
Isoform 3 (identifier: Q96LA6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     296-334: Missing.
     372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP
Isoform 4 (identifier: Q96LA6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG
     239-429: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1616 Potential
Chain17 – 429413Fc receptor-like protein 1
PRO_0000331638

Regions

Topological domain17 – 307291Extracellular Potential
Transmembrane308 – 32821Helical; Potential
Topological domain329 – 429101Cytoplasmic Potential
Domain17 – 10488Ig-like C2-type 1
Domain109 – 20092Ig-like C2-type 2
Domain208 – 29184Ig-like C2-type 3
Motif354 – 3596ITIM motif 1
Motif367 – 3726ITIM motif 2
Motif379 – 3846ITIM motif 3
Motif410 – 4156ITIM motif 4
Motif423 – 4286ITIM motif 5

Amino acid modifications

Glycosylation2931N-linked (GlcNAc...) Potential
Disulfide bond38 ↔ 86 By similarity
Disulfide bond134 ↔ 183 By similarity
Disulfide bond229 ↔ 276 By similarity

Natural variations

Alternative sequence1 – 3939Missing in isoform 4.
VSP_033290
Alternative sequence203 – 23836IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4.
VSP_033291
Alternative sequence239 – 429191Missing in isoform 4.
VSP_033292
Alternative sequence296 – 33439Missing in isoform 3.
VSP_033293
Alternative sequence372 – 42958VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3.
VSP_033294
Alternative sequence3951Missing in isoform 2.
VSP_033295
Natural variant1241V → M.
Corresponds to variant rs12078586 [ dbSNP | Ensembl ].
VAR_042923

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: F6BB19942C9C7C06

FASTA42946,936
        10         20         30         40         50         60 
MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF QFCFFRDTRA 

        70         80         90        100        110        120 
LGPGWSSSPK LQIAAMWKED TGSYWCEAQT MASKVLRSRR SQINVHRVPV ADVSLETQPP 

       130        140        150        160        170        180 
GGQVMEGDRL VLICSVAMGT GDITFLWYKG AVGLNLQSKT QRSLTAEYEI PSVRESDAEQ 

       190        200        210        220        230        240 
YYCVAENGYG PSPSGLVSIT VRIPVSRPIL MLRAPRAQAA VEDVLELHCE ALRGSPPILY 

       250        260        270        280        290        300 
WFYHEDITLG SRSAPSGGGA SFNLSLTEEH SGNYSCEANN GLGAQRSEAV TLNFTVPTGA 

       310        320        330        340        350        360 
RSNHLTSGVI EGLLSTLGPA TVALLFCYGL KRKIGRRSAR DPLRSLPSPL PQEFTYLNSP 

       370        380        390        400        410        420 
TPGQLQPIYE NVNVVSGDEV YSLAYYNQPE QESVAAETLG THMEDKVSLD IYSRLRKANI 


TDVDYEDAM 

« Hide

Isoform 2 [UniParc].

Checksum: F20BA3110BBC7828
Show »

FASTA42846,865
Isoform 3 [UniParc].

Checksum: 6F79D0F9EBDE2AE0
Show »

FASTA36640,435
Isoform 4 [UniParc].

Checksum: B64B24B45F3C19B2
Show »

FASTA19922,068

References

« Hide 'large scale' references
[1]"Identification of a family of Fc receptor homologs with preferential B cell expression."
Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Lymph node.
[2]"A family of highly diverse human and mouse genes structurally links leukocyte FcR, gp42 and PECAM-1."
Guselnikov S.V., Ershova S.A., Mechetina L.V., Najakshin A.M., Volkova O.Y., Alabyev B.Y., Taranin A.V.
Immunogenetics 54:87-95(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Tonsil.
[3]Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A.
Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Peripheral blood.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Lymph node.
[6]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Blood.
[9]"IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: CHARACTERIZATION, TISSUE SPECIFICITY.
[10]"FcRH1: an activation coreceptor on human B cells."
Leu C.-M., Davis R.S., Gartland L.A., Fine W.D., Cooper M.D.
Blood 105:1121-1126(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, INDUCTION, TISSUE SPECIFICITY.
[11]"Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY043464 mRNA. Translation: AAK91777.1.
AF329488 mRNA. Translation: AAL23898.1.
EF064734 Genomic DNA. Translation: ABK41917.1.
AK096690 mRNA. Translation: BAC04842.1.
AK315748 mRNA. Translation: BAG38102.1.
AL833970 mRNA. Translation: CAD38815.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70232.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70233.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70234.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73052.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73053.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73054.1.
CH471121 Genomic DNA. Translation: EAW52861.1.
CH471121 Genomic DNA. Translation: EAW52862.1.
BC033690 mRNA. Translation: AAH33690.1.
RefSeqNP_001152869.1. NM_001159397.1.
NP_001152870.1. NM_001159398.1.
NP_443170.1. NM_052938.4.
UniGeneHs.656112.

3D structure databases

ProteinModelPortalQ96LA6.
SMRQ96LA6. Positions 31-297.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000357158.

Polymorphism databases

DMDM74760931.

Proteomic databases

PaxDbQ96LA6.
PRIDEQ96LA6.

Protocols and materials databases

DNASU115350.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000358292; ENSP00000351039; ENSG00000163534. [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534. [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534. [Q96LA6-2]
GeneID115350.
KEGGhsa:115350.
UCSCuc001frg.3. human. [Q96LA6-1]
uc001frh.3. human. [Q96LA6-2]
uc001fri.3. human. [Q96LA6-3]

Organism-specific databases

CTD115350.
GeneCardsGC01M157764.
HGNCHGNC:18509. FCRL1.
HPAHPA013323.
MIM606508. gene.
neXtProtNX_Q96LA6.
PharmGKBPA142671766.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG44406.
HOGENOMHOG000036945.
HOVERGENHBG074073.
InParanoidQ96LA6.
OMAQFQFCFF.
OrthoDBEOG7BP81V.
PhylomeDBQ96LA6.
TreeFamTF351107.

Gene expression databases

BgeeQ96LA6.
CleanExHS_FCRL1.
GenevestigatorQ96LA6.

Family and domain databases

Gene3D2.60.40.10. 3 hits.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTSM00409. IG. 3 hits.
[Graphical view]
PROSITEPS50835. IG_LIKE. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFCRL1. human.
GeneWikiFCRL1.
GenomeRNAi115350.
NextBio79570.
PROQ96LA6.
SOURCESearch...

Entry information

Entry nameFCRL1_HUMAN
AccessionPrimary (citable) accession number: Q96LA6
Secondary accession number(s): B2RE05 expand/collapse secondary AC list , Q8N759, Q8NDI0, Q96PJ6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: December 1, 2001
Last modified: April 16, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM

Human cell differentiation molecules

CD nomenclature of surface proteins of human leucocytes and list of entries