Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96LA6

- FCRL1_HUMAN

UniProt

Q96LA6 - FCRL1_HUMAN

Protein

Fc receptor-like protein 1

Gene

FCRL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation.1 Publication

    Keywords - Molecular functioni

    Receptor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Fc receptor-like protein 1
    Short name:
    FcR-like protein 1
    Short name:
    FcRL1
    Alternative name(s):
    Fc receptor homolog 1
    Short name:
    FcRH1
    IFGP family protein 1
    Short name:
    hIFGP1
    Immune receptor translocation-associated protein 5
    CD_antigen: CD307a
    Gene namesi
    Name:FCRL1
    Synonyms:FCRH1, IFGP1, IRTA5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:18509. FCRL1.

    Subcellular locationi

    Cell membrane 2 Publications; Single-pass type I membrane protein 2 Publications

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671766.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1616Sequence AnalysisAdd
    BLAST
    Chaini17 – 429413Fc receptor-like protein 1PRO_0000331638Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi38 ↔ 86PROSITE-ProRule annotation
    Disulfide bondi134 ↔ 183PROSITE-ProRule annotation
    Disulfide bondi229 ↔ 276PROSITE-ProRule annotation
    Glycosylationi293 – 2931N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylated on tyrosines upon activation.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ96LA6.
    PRIDEiQ96LA6.

    Expressioni

    Tissue specificityi

    Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).4 Publications

    Inductioni

    Down-regulated in activated B-cells.1 Publication

    Gene expression databases

    BgeeiQ96LA6.
    CleanExiHS_FCRL1.
    GenevestigatoriQ96LA6.

    Organism-specific databases

    HPAiHPA013323.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000357158.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96LA6.
    SMRiQ96LA6. Positions 21-297.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini17 – 307291ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini329 – 429101CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei308 – 32821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini17 – 10488Ig-like C2-type 1Add
    BLAST
    Domaini109 – 20092Ig-like C2-type 2Add
    BLAST
    Domaini208 – 29184Ig-like C2-type 3Add
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi354 – 3596ITIM motif 1
    Motifi367 – 3726ITIM motif 2
    Motifi379 – 3846ITIM motif 3
    Motifi410 – 4156ITIM motif 4
    Motifi423 – 4286ITIM motif 5

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG44406.
    HOGENOMiHOG000036945.
    HOVERGENiHBG074073.
    InParanoidiQ96LA6.
    OMAiQFQFCFF.
    OrthoDBiEOG7BP81V.
    PhylomeDBiQ96LA6.
    TreeFamiTF351107.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view]
    SMARTiSM00409. IG. 3 hits.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 3 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96LA6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF    50
    QFCFFRDTRA LGPGWSSSPK LQIAAMWKED TGSYWCEAQT MASKVLRSRR 100
    SQINVHRVPV ADVSLETQPP GGQVMEGDRL VLICSVAMGT GDITFLWYKG 150
    AVGLNLQSKT QRSLTAEYEI PSVRESDAEQ YYCVAENGYG PSPSGLVSIT 200
    VRIPVSRPIL MLRAPRAQAA VEDVLELHCE ALRGSPPILY WFYHEDITLG 250
    SRSAPSGGGA SFNLSLTEEH SGNYSCEANN GLGAQRSEAV TLNFTVPTGA 300
    RSNHLTSGVI EGLLSTLGPA TVALLFCYGL KRKIGRRSAR DPLRSLPSPL 350
    PQEFTYLNSP TPGQLQPIYE NVNVVSGDEV YSLAYYNQPE QESVAAETLG 400
    THMEDKVSLD IYSRLRKANI TDVDYEDAM 429
    Length:429
    Mass (Da):46,936
    Last modified:December 1, 2001 - v1
    Checksum:iF6BB19942C9C7C06
    GO
    Isoform 2 (identifier: Q96LA6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         395-395: Missing.

    Show »
    Length:428
    Mass (Da):46,865
    Checksum:iF20BA3110BBC7828
    GO
    Isoform 3 (identifier: Q96LA6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         296-334: Missing.
         372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP

    Show »
    Length:366
    Mass (Da):40,435
    Checksum:i6F79D0F9EBDE2AE0
    GO
    Isoform 4 (identifier: Q96LA6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: Missing.
         203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG
         239-429: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:199
    Mass (Da):22,068
    Checksum:iB64B24B45F3C19B2
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti124 – 1241V → M.
    Corresponds to variant rs12078586 [ dbSNP | Ensembl ].
    VAR_042923

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3939Missing in isoform 4. 1 PublicationVSP_033290Add
    BLAST
    Alternative sequencei203 – 23836IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4. 1 PublicationVSP_033291Add
    BLAST
    Alternative sequencei239 – 429191Missing in isoform 4. 1 PublicationVSP_033292Add
    BLAST
    Alternative sequencei296 – 33439Missing in isoform 3. 1 PublicationVSP_033293Add
    BLAST
    Alternative sequencei372 – 42958VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3. 1 PublicationVSP_033294Add
    BLAST
    Alternative sequencei395 – 3951Missing in isoform 2. 1 PublicationVSP_033295

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY043464 mRNA. Translation: AAK91777.1.
    AF329488 mRNA. Translation: AAL23898.1.
    EF064734 Genomic DNA. Translation: ABK41917.1.
    AK096690 mRNA. Translation: BAC04842.1.
    AK315748 mRNA. Translation: BAG38102.1.
    AL833970 mRNA. Translation: CAD38815.1.
    AL139409, AL356276 Genomic DNA. Translation: CAH70232.1.
    AL139409, AL356276 Genomic DNA. Translation: CAH70233.1.
    AL139409, AL356276 Genomic DNA. Translation: CAH70234.1.
    AL356276, AL139409 Genomic DNA. Translation: CAH73052.1.
    AL356276, AL139409 Genomic DNA. Translation: CAH73053.1.
    AL356276, AL139409 Genomic DNA. Translation: CAH73054.1.
    CH471121 Genomic DNA. Translation: EAW52861.1.
    CH471121 Genomic DNA. Translation: EAW52862.1.
    BC033690 mRNA. Translation: AAH33690.1.
    CCDSiCCDS1170.1. [Q96LA6-1]
    CCDS53382.1. [Q96LA6-3]
    CCDS53383.1. [Q96LA6-2]
    RefSeqiNP_001152869.1. NM_001159397.1. [Q96LA6-3]
    NP_001152870.1. NM_001159398.1. [Q96LA6-2]
    NP_443170.1. NM_052938.4. [Q96LA6-1]
    UniGeneiHs.656112.

    Genome annotation databases

    EnsembliENST00000358292; ENSP00000351039; ENSG00000163534. [Q96LA6-3]
    ENST00000368176; ENSP00000357158; ENSG00000163534. [Q96LA6-1]
    ENST00000491942; ENSP00000418130; ENSG00000163534. [Q96LA6-2]
    GeneIDi115350.
    KEGGihsa:115350.
    UCSCiuc001frg.3. human. [Q96LA6-1]
    uc001frh.3. human. [Q96LA6-2]
    uc001fri.3. human. [Q96LA6-3]

    Polymorphism databases

    DMDMi74760931.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY043464 mRNA. Translation: AAK91777.1 .
    AF329488 mRNA. Translation: AAL23898.1 .
    EF064734 Genomic DNA. Translation: ABK41917.1 .
    AK096690 mRNA. Translation: BAC04842.1 .
    AK315748 mRNA. Translation: BAG38102.1 .
    AL833970 mRNA. Translation: CAD38815.1 .
    AL139409 , AL356276 Genomic DNA. Translation: CAH70232.1 .
    AL139409 , AL356276 Genomic DNA. Translation: CAH70233.1 .
    AL139409 , AL356276 Genomic DNA. Translation: CAH70234.1 .
    AL356276 , AL139409 Genomic DNA. Translation: CAH73052.1 .
    AL356276 , AL139409 Genomic DNA. Translation: CAH73053.1 .
    AL356276 , AL139409 Genomic DNA. Translation: CAH73054.1 .
    CH471121 Genomic DNA. Translation: EAW52861.1 .
    CH471121 Genomic DNA. Translation: EAW52862.1 .
    BC033690 mRNA. Translation: AAH33690.1 .
    CCDSi CCDS1170.1. [Q96LA6-1 ]
    CCDS53382.1. [Q96LA6-3 ]
    CCDS53383.1. [Q96LA6-2 ]
    RefSeqi NP_001152869.1. NM_001159397.1. [Q96LA6-3 ]
    NP_001152870.1. NM_001159398.1. [Q96LA6-2 ]
    NP_443170.1. NM_052938.4. [Q96LA6-1 ]
    UniGenei Hs.656112.

    3D structure databases

    ProteinModelPortali Q96LA6.
    SMRi Q96LA6. Positions 21-297.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000357158.

    Polymorphism databases

    DMDMi 74760931.

    Proteomic databases

    PaxDbi Q96LA6.
    PRIDEi Q96LA6.

    Protocols and materials databases

    DNASUi 115350.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000358292 ; ENSP00000351039 ; ENSG00000163534 . [Q96LA6-3 ]
    ENST00000368176 ; ENSP00000357158 ; ENSG00000163534 . [Q96LA6-1 ]
    ENST00000491942 ; ENSP00000418130 ; ENSG00000163534 . [Q96LA6-2 ]
    GeneIDi 115350.
    KEGGi hsa:115350.
    UCSCi uc001frg.3. human. [Q96LA6-1 ]
    uc001frh.3. human. [Q96LA6-2 ]
    uc001fri.3. human. [Q96LA6-3 ]

    Organism-specific databases

    CTDi 115350.
    GeneCardsi GC01M157764.
    HGNCi HGNC:18509. FCRL1.
    HPAi HPA013323.
    MIMi 606508. gene.
    neXtProti NX_Q96LA6.
    PharmGKBi PA142671766.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG44406.
    HOGENOMi HOG000036945.
    HOVERGENi HBG074073.
    InParanoidi Q96LA6.
    OMAi QFQFCFF.
    OrthoDBi EOG7BP81V.
    PhylomeDBi Q96LA6.
    TreeFami TF351107.

    Miscellaneous databases

    ChiTaRSi FCRL1. human.
    GeneWikii FCRL1.
    GenomeRNAii 115350.
    NextBioi 79570.
    PROi Q96LA6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q96LA6.
    CleanExi HS_FCRL1.
    Genevestigatori Q96LA6.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR003599. Ig_sub.
    [Graphical view ]
    SMARTi SM00409. IG. 3 hits.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a family of Fc receptor homologs with preferential B cell expression."
      Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
      Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Lymph node.
    2. "A family of highly diverse human and mouse genes structurally links leukocyte FcR, gp42 and PECAM-1."
      Guselnikov S.V., Ershova S.A., Mechetina L.V., Najakshin A.M., Volkova O.Y., Alabyev B.Y., Taranin A.V.
      Immunogenetics 54:87-95(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Tonsil.
    3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Peripheral blood.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Lymph node.
    6. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Blood.
    9. "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
      Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
      Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: CHARACTERIZATION, TISSUE SPECIFICITY.
    10. "FcRH1: an activation coreceptor on human B cells."
      Leu C.-M., Davis R.S., Gartland L.A., Fine W.D., Cooper M.D.
      Blood 105:1121-1126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, INDUCTION, TISSUE SPECIFICITY.
    11. "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
      Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
      Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiFCRL1_HUMAN
    AccessioniPrimary (citable) accession number: Q96LA6
    Secondary accession number(s): B2RE05
    , Q8N759, Q8NDI0, Q96PJ6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 120 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human cell differentiation molecules
      CD nomenclature of surface proteins of human leucocytes and list of entries
    2. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3