SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96LA6

- FCRL1_HUMAN

UniProt

Q96LA6 - FCRL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Fc receptor-like protein 1
Gene
FCRL1, FCRH1, IFGP1, IRTA5
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation.1 Publication

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Fc receptor-like protein 1
Short name:
FcR-like protein 1
Short name:
FcRL1
Alternative name(s):
Fc receptor homolog 1
Short name:
FcRH1
IFGP family protein 1
Short name:
hIFGP1
Immune receptor translocation-associated protein 5
CD_antigen: CD307a
Gene namesi
Name:FCRL1
Synonyms:FCRH1, IFGP1, IRTA5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:18509. FCRL1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein 2 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini17 – 307291Extracellular Reviewed prediction
Add
BLAST
Transmembranei308 – 32821Helical; Reviewed prediction
Add
BLAST
Topological domaini329 – 429101Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671766.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1616 Reviewed prediction
Add
BLAST
Chaini17 – 429413Fc receptor-like protein 1
PRO_0000331638Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi38 ↔ 86 By similarity
Disulfide bondi134 ↔ 183 By similarity
Disulfide bondi229 ↔ 276 By similarity
Glycosylationi293 – 2931N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Phosphorylated on tyrosines upon activation.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ96LA6.
PRIDEiQ96LA6.

Expressioni

Tissue specificityi

Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level).4 Publications

Inductioni

Down-regulated in activated B-cells.1 Publication

Gene expression databases

BgeeiQ96LA6.
CleanExiHS_FCRL1.
GenevestigatoriQ96LA6.

Organism-specific databases

HPAiHPA013323.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000357158.

Structurei

3D structure databases

ProteinModelPortaliQ96LA6.
SMRiQ96LA6. Positions 21-297.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini17 – 10488Ig-like C2-type 1
Add
BLAST
Domaini109 – 20092Ig-like C2-type 2
Add
BLAST
Domaini208 – 29184Ig-like C2-type 3
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi354 – 3596ITIM motif 1
Motifi367 – 3726ITIM motif 2
Motifi379 – 3846ITIM motif 3
Motifi410 – 4156ITIM motif 4
Motifi423 – 4286ITIM motif 5

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG44406.
HOGENOMiHOG000036945.
HOVERGENiHBG074073.
InParanoidiQ96LA6.
OMAiQFQFCFF.
OrthoDBiEOG7BP81V.
PhylomeDBiQ96LA6.
TreeFamiTF351107.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view]
SMARTiSM00409. IG. 3 hits.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96LA6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLPRLLLLIC APLCEPAELF LIASPSHPTE GSPVTLTCKM PFLQSSDAQF    50
QFCFFRDTRA LGPGWSSSPK LQIAAMWKED TGSYWCEAQT MASKVLRSRR 100
SQINVHRVPV ADVSLETQPP GGQVMEGDRL VLICSVAMGT GDITFLWYKG 150
AVGLNLQSKT QRSLTAEYEI PSVRESDAEQ YYCVAENGYG PSPSGLVSIT 200
VRIPVSRPIL MLRAPRAQAA VEDVLELHCE ALRGSPPILY WFYHEDITLG 250
SRSAPSGGGA SFNLSLTEEH SGNYSCEANN GLGAQRSEAV TLNFTVPTGA 300
RSNHLTSGVI EGLLSTLGPA TVALLFCYGL KRKIGRRSAR DPLRSLPSPL 350
PQEFTYLNSP TPGQLQPIYE NVNVVSGDEV YSLAYYNQPE QESVAAETLG 400
THMEDKVSLD IYSRLRKANI TDVDYEDAM 429
Length:429
Mass (Da):46,936
Last modified:December 1, 2001 - v1
Checksum:iF6BB19942C9C7C06
GO
Isoform 2 (identifier: Q96LA6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-395: Missing.

Show »
Length:428
Mass (Da):46,865
Checksum:iF20BA3110BBC7828
GO
Isoform 3 (identifier: Q96LA6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-334: Missing.
     372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP

Show »
Length:366
Mass (Da):40,435
Checksum:i6F79D0F9EBDE2AE0
GO
Isoform 4 (identifier: Q96LA6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.
     203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG
     239-429: Missing.

Note: No experimental confirmation available.

Show »
Length:199
Mass (Da):22,068
Checksum:iB64B24B45F3C19B2
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti124 – 1241V → M.
Corresponds to variant rs12078586 [ dbSNP | Ensembl ].
VAR_042923

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939Missing in isoform 4.
VSP_033290Add
BLAST
Alternative sequencei203 – 23836IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4.
VSP_033291Add
BLAST
Alternative sequencei239 – 429191Missing in isoform 4.
VSP_033292Add
BLAST
Alternative sequencei296 – 33439Missing in isoform 3.
VSP_033293Add
BLAST
Alternative sequencei372 – 42958VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3.
VSP_033294Add
BLAST
Alternative sequencei395 – 3951Missing in isoform 2.
VSP_033295

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY043464 mRNA. Translation: AAK91777.1.
AF329488 mRNA. Translation: AAL23898.1.
EF064734 Genomic DNA. Translation: ABK41917.1.
AK096690 mRNA. Translation: BAC04842.1.
AK315748 mRNA. Translation: BAG38102.1.
AL833970 mRNA. Translation: CAD38815.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70232.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70233.1.
AL139409, AL356276 Genomic DNA. Translation: CAH70234.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73052.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73053.1.
AL356276, AL139409 Genomic DNA. Translation: CAH73054.1.
CH471121 Genomic DNA. Translation: EAW52861.1.
CH471121 Genomic DNA. Translation: EAW52862.1.
BC033690 mRNA. Translation: AAH33690.1.
CCDSiCCDS1170.1. [Q96LA6-1]
CCDS53382.1. [Q96LA6-3]
CCDS53383.1. [Q96LA6-2]
RefSeqiNP_001152869.1. NM_001159397.1. [Q96LA6-3]
NP_001152870.1. NM_001159398.1. [Q96LA6-2]
NP_443170.1. NM_052938.4. [Q96LA6-1]
UniGeneiHs.656112.

Genome annotation databases

EnsembliENST00000358292; ENSP00000351039; ENSG00000163534. [Q96LA6-3]
ENST00000368176; ENSP00000357158; ENSG00000163534. [Q96LA6-1]
ENST00000491942; ENSP00000418130; ENSG00000163534. [Q96LA6-2]
GeneIDi115350.
KEGGihsa:115350.
UCSCiuc001frg.3. human. [Q96LA6-1]
uc001frh.3. human. [Q96LA6-2]
uc001fri.3. human. [Q96LA6-3]

Polymorphism databases

DMDMi74760931.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY043464 mRNA. Translation: AAK91777.1 .
AF329488 mRNA. Translation: AAL23898.1 .
EF064734 Genomic DNA. Translation: ABK41917.1 .
AK096690 mRNA. Translation: BAC04842.1 .
AK315748 mRNA. Translation: BAG38102.1 .
AL833970 mRNA. Translation: CAD38815.1 .
AL139409 , AL356276 Genomic DNA. Translation: CAH70232.1 .
AL139409 , AL356276 Genomic DNA. Translation: CAH70233.1 .
AL139409 , AL356276 Genomic DNA. Translation: CAH70234.1 .
AL356276 , AL139409 Genomic DNA. Translation: CAH73052.1 .
AL356276 , AL139409 Genomic DNA. Translation: CAH73053.1 .
AL356276 , AL139409 Genomic DNA. Translation: CAH73054.1 .
CH471121 Genomic DNA. Translation: EAW52861.1 .
CH471121 Genomic DNA. Translation: EAW52862.1 .
BC033690 mRNA. Translation: AAH33690.1 .
CCDSi CCDS1170.1. [Q96LA6-1 ]
CCDS53382.1. [Q96LA6-3 ]
CCDS53383.1. [Q96LA6-2 ]
RefSeqi NP_001152869.1. NM_001159397.1. [Q96LA6-3 ]
NP_001152870.1. NM_001159398.1. [Q96LA6-2 ]
NP_443170.1. NM_052938.4. [Q96LA6-1 ]
UniGenei Hs.656112.

3D structure databases

ProteinModelPortali Q96LA6.
SMRi Q96LA6. Positions 21-297.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000357158.

Polymorphism databases

DMDMi 74760931.

Proteomic databases

PaxDbi Q96LA6.
PRIDEi Q96LA6.

Protocols and materials databases

DNASUi 115350.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000358292 ; ENSP00000351039 ; ENSG00000163534 . [Q96LA6-3 ]
ENST00000368176 ; ENSP00000357158 ; ENSG00000163534 . [Q96LA6-1 ]
ENST00000491942 ; ENSP00000418130 ; ENSG00000163534 . [Q96LA6-2 ]
GeneIDi 115350.
KEGGi hsa:115350.
UCSCi uc001frg.3. human. [Q96LA6-1 ]
uc001frh.3. human. [Q96LA6-2 ]
uc001fri.3. human. [Q96LA6-3 ]

Organism-specific databases

CTDi 115350.
GeneCardsi GC01M157764.
HGNCi HGNC:18509. FCRL1.
HPAi HPA013323.
MIMi 606508. gene.
neXtProti NX_Q96LA6.
PharmGKBi PA142671766.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44406.
HOGENOMi HOG000036945.
HOVERGENi HBG074073.
InParanoidi Q96LA6.
OMAi QFQFCFF.
OrthoDBi EOG7BP81V.
PhylomeDBi Q96LA6.
TreeFami TF351107.

Miscellaneous databases

ChiTaRSi FCRL1. human.
GeneWikii FCRL1.
GenomeRNAii 115350.
NextBioi 79570.
PROi Q96LA6.
SOURCEi Search...

Gene expression databases

Bgeei Q96LA6.
CleanExi HS_FCRL1.
Genevestigatori Q96LA6.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003599. Ig_sub.
[Graphical view ]
SMARTi SM00409. IG. 3 hits.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a family of Fc receptor homologs with preferential B cell expression."
    Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D.
    Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Lymph node.
  2. "A family of highly diverse human and mouse genes structurally links leukocyte FcR, gp42 and PECAM-1."
    Guselnikov S.V., Ershova S.A., Mechetina L.V., Najakshin A.M., Volkova O.Y., Alabyev B.Y., Taranin A.V.
    Immunogenetics 54:87-95(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Tonsil.
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Peripheral blood.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Lymph node.
  6. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Blood.
  9. "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells."
    Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R.
    Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: CHARACTERIZATION, TISSUE SPECIFICITY.
  10. "FcRH1: an activation coreceptor on human B cells."
    Leu C.-M., Davis R.S., Gartland L.A., Fine W.D., Cooper M.D.
    Blood 105:1121-1126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, INDUCTION, TISSUE SPECIFICITY.
  11. "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia."
    Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A.
    Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiFCRL1_HUMAN
AccessioniPrimary (citable) accession number: Q96LA6
Secondary accession number(s): B2RE05
, Q8N759, Q8NDI0, Q96PJ6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi