Q96LA6 (FCRL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Fc receptor-like protein 1 Short name=FcR-like protein 1 Short name=FcRL1 Alternative name(s): Fc receptor homolog 1 Short name=FcRH1 IFGP family protein 1 Short name=hIFGP1 Immune receptor translocation-associated protein 5 CD_antigen=CD307a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 429 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May function as an activating coreceptor in B-cells. May function in B-cells activation and differentiation. Ref.10 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Ref.10 Ref.11. |
| Tissue specificity | Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level). Ref.1 Ref.9 Ref.10 Ref.11 |
| Induction | Down-regulated in activated B-cells. Ref.10 |
| Post-translational modification | Phosphorylated on tyrosines upon activation. Ref.10 |
| Sequence similarities | Contains 3 Ig-like C2-type (immunoglobulin-like) domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96LA6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96LA6-2) The sequence of this isoform differs from the canonical sequence as follows: 395-395: Missing. | ||||||
| Isoform 3 (identifier: Q96LA6-3) The sequence of this isoform differs from the canonical sequence as follows: 296-334: Missing. 372-429: VNVVSGDEVY...ITDVDYEDAM → EPREQSVAVHGRQQHSSEQKAQKPWGHIWRTRFP | ||||||
| Isoform 4 (identifier: Q96LA6-4) The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. 203-238: IPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPI → SKFHYPSFSQPVTNWAPHFPGAHKVSLGHAEEVQWG 239-429: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||||
| Chain | 17 – 429 | 413 | Fc receptor-like protein 1 | PRO_0000331638 | |||||||
Regions | |||||||||||
| Topological domain | 17 – 307 | 291 | Extracellular Potential | ||||||||
| Transmembrane | 308 – 328 | 21 | Helical; Potential | ||||||||
| Topological domain | 329 – 429 | 101 | Cytoplasmic Potential | ||||||||
| Domain | 17 – 104 | 88 | Ig-like C2-type 1 | ||||||||
| Domain | 109 – 200 | 92 | Ig-like C2-type 2 | ||||||||
| Domain | 208 – 291 | 84 | Ig-like C2-type 3 | ||||||||
| Motif | 354 – 359 | 6 | ITIM motif 1 | ||||||||
| Motif | 367 – 372 | 6 | ITIM motif 2 | ||||||||
| Motif | 379 – 384 | 6 | ITIM motif 3 | ||||||||
| Motif | 410 – 415 | 6 | ITIM motif 4 | ||||||||
| Motif | 423 – 428 | 6 | ITIM motif 5 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 293 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 38 ↔ 86 | By similarity | |||||||||
| Disulfide bond | 134 ↔ 183 | By similarity | |||||||||
| Disulfide bond | 229 ↔ 276 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 39 | 39 | Missing in isoform 4. | VSP_033290 | |||||||
| Alternative sequence | 203 – 238 | 36 | IPVSR…GSPPI → SKFHYPSFSQPVTNWAPHFP GAHKVSLGHAEEVQWG in isoform 4. | VSP_033291 | |||||||
| Alternative sequence | 239 – 429 | 191 | Missing in isoform 4. | VSP_033292 | |||||||
| Alternative sequence | 296 – 334 | 39 | Missing in isoform 3. | VSP_033293 | |||||||
| Alternative sequence | 372 – 429 | 58 | VNVVS…YEDAM → EPREQSVAVHGRQQHSSEQK AQKPWGHIWRTRFP in isoform 3. | VSP_033294 | |||||||
| Alternative sequence | 395 | 1 | Missing in isoform 2. | VSP_033295 | |||||||
| Natural variant | 124 | 1 | V → M. Corresponds to variant rs12078586 [ dbSNP | Ensembl ]. | VAR_042923 | |||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a family of Fc receptor homologs with preferential B cell expression." Davis R.S., Wang Y.-H., Kubagawa H., Cooper M.D. Proc. Natl. Acad. Sci. U.S.A. 98:9772-9777(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Lymph node. |
| [2] | "A family of highly diverse human and mouse genes structurally links leukocyte FcR, gp42 and PECAM-1." Guselnikov S.V., Ershova S.A., Mechetina L.V., Najakshin A.M., Volkova O.Y., Alabyev B.Y., Taranin A.V. Immunogenetics 54:87-95(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Tonsil. |
| [3] | Livingston R.J., Shaffer T., McFarland I., Nguyen C.P., Stanaway I.B., Rajkumar N., Johnson E.J., da Ponte S.H., Willa H., Ahearn M.O., Bertucci C., Acklestad J., Carroll A., Swanson J., Gildersleeve H.I., Nickerson D.A. Submitted (OCT-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Peripheral blood. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Lymph node. |
| [6] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Blood. |
| [9] | "IRTAs: a new family of immunoglobulin-like receptors differentially expressed in B cells." Miller I., Hatzivassiliou G., Cattoretti G., Mendelsohn C., Dalla-Favera R. Blood 99:2662-2669(2002) [PubMed] [Europe PMC] [Abstract] Cited for: CHARACTERIZATION, TISSUE SPECIFICITY. |
| [10] | "FcRH1: an activation coreceptor on human B cells." Leu C.-M., Davis R.S., Gartland L.A., Fine W.D., Cooper M.D. Blood 105:1121-1126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PHOSPHORYLATION, INDUCTION, TISSUE SPECIFICITY. |
| [11] | "Expression pattern of the human FcRH/IRTA receptors in normal tissue and in B-chronic lymphocytic leukemia." Polson A.G., Zheng B., Elkins K., Chang W., Du C., Dowd P., Yen L., Tan C., Hongo J.-A., Koeppen H., Ebens A. Int. Immunol. 18:1363-1373(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY043464 mRNA. Translation: AAK91777.1. AF329488 mRNA. Translation: AAL23898.1. EF064734 Genomic DNA. Translation: ABK41917.1. AK096690 mRNA. Translation: BAC04842.1. AK315748 mRNA. Translation: BAG38102.1. AL833970 mRNA. Translation: CAD38815.1. AL139409, AL356276 Genomic DNA. Translation: CAH70232.1. AL139409, AL356276 Genomic DNA. Translation: CAH70233.1. AL139409, AL356276 Genomic DNA. Translation: CAH70234.1. AL356276, AL139409 Genomic DNA. Translation: CAH73052.1. AL356276, AL139409 Genomic DNA. Translation: CAH73053.1. AL356276, AL139409 Genomic DNA. Translation: CAH73054.1. CH471121 Genomic DNA. Translation: EAW52861.1. CH471121 Genomic DNA. Translation: EAW52862.1. BC033690 mRNA. Translation: AAH33690.1. |
| IPI | IPI00064951. IPI00167103. IPI00386065. IPI00644153. |
| RefSeq | NP_001152869.1. NM_001159397.1. NP_001152870.1. NM_001159398.1. NP_443170.1. NM_052938.4. |
| UniGene | Hs.656112. |
3D structure databases | |
| ProteinModelPortal | Q96LA6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000357158. |
Polymorphism databases | |
| DMDM | 74760931. |
Proteomic databases | |
| PaxDb | Q96LA6. |
| PRIDE | Q96LA6. |
Protocols and materials databases | |
| DNASU | 115350. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358292; ENSP00000351039; ENSG00000163534. ENST00000368176; ENSP00000357158; ENSG00000163534. ENST00000491942; ENSP00000418130; ENSG00000163534. |
| GeneID | 115350. |
| KEGG | hsa:115350. |
| UCSC | uc001frg.3. human. uc001frh.3. human. uc001fri.3. human. |
Organism-specific databases | |
| CTD | 115350. |
| GeneCards | GC01M157764. |
| HGNC | HGNC:18509. FCRL1. |
| HPA | HPA013323. |
| MIM | 606508. gene. |
| neXtProt | NX_Q96LA6. |
| PharmGKB | PA142671766. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG44406. |
| HOGENOM | HOG000036945. |
| HOVERGEN | HBG074073. |
| InParanoid | Q96LA6. |
| OMA | QFQFCFF. |
Gene expression databases | |
| Bgee | Q96LA6. |
| CleanEx | HS_FCRL1. |
| Genevestigator | Q96LA6. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 3 hits. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR003599. Ig_sub. [Graphical view] |
| SMART | SM00409. IG. 3 hits. [Graphical view] |
| PROSITE | PS50835. IG_LIKE. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FCRL1. human. |
| GenomeRNAi | 115350. |
| NextBio | 79570. |
| SOURCE | Search... |
Entry information
| Entry name | FCRL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96LA6 Secondary accession number(s): B2RE05 Q96PJ6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human cell differentiation molecules CD nomenclature of surface proteins of human leucocytes and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
