Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ecto-ADP-ribosyltransferase 5

Gene

ART5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

NAD+ + protein-L-arginine = nicotinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei99 – 991NADBy similarity
Binding sitei160 – 1601NADBy similarity
Binding sitei180 – 1801NADBy similarity
Binding sitei214 – 2141NADBy similarity
Active sitei228 – 2281By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Ligandi

NAD, NADP

Names & Taxonomyi

Protein namesi
Recommended name:
Ecto-ADP-ribosyltransferase 5 (EC:2.4.2.31)
Alternative name(s):
ADP-ribosyltransferase C2 and C3 toxin-like 5
Short name:
ARTC5
Mono(ADP-ribosyl)transferase 5
NAD(P)(+)--arginine ADP-ribosyltransferase 5
Gene namesi
Name:ART5
ORF Names:UNQ575/PRO1137
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:24049. ART5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134887713.

Polymorphism and mutation databases

BioMutaiART5.
DMDMi296439487.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence analysisAdd
BLAST
Chaini23 – 291269Ecto-ADP-ribosyltransferase 5PRO_0000019333Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi42 ↔ 258By similarity
Glycosylationi101 – 1011N-linked (GlcNAc...)Sequence analysis
Glycosylationi196 – 1961N-linked (GlcNAc...)Sequence analysis
Glycosylationi250 – 2501N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiQ96L15.
PaxDbiQ96L15.
PeptideAtlasiQ96L15.
PRIDEiQ96L15.

Expressioni

Gene expression databases

BgeeiQ96L15.
CleanExiHS_ART5.
ExpressionAtlasiQ96L15. baseline and differential.
GenevisibleiQ96L15. HS.

Organism-specific databases

HPAiHPA041637.
HPA044099.

Interactioni

Protein-protein interaction databases

BioGridi125545. 1 interaction.
STRINGi9606.ENSP00000352992.

Structurei

3D structure databases

ProteinModelPortaliQ96L15.
SMRiQ96L15. Positions 26-260.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IVE0. Eukaryota.
ENOG4111WZG. LUCA.
GeneTreeiENSGT00530000062975.
HOGENOMiHOG000273888.
HOVERGENiHBG004464.
InParanoidiQ96L15.
KOiK19977.
OMAiRETVMAK.
PhylomeDBiQ96L15.
TreeFamiTF335356.

Family and domain databases

InterProiIPR000768. ART.
[Graphical view]
PfamiPF01129. ART. 1 hit.
[Graphical view]
PRINTSiPR00970. RIBTRNSFRASE.
PROSITEiPS01291. ART. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96L15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALAALMIAL GSLGLHTWQA QAVPILPLGL APDTFDDTYV GCAEEMEEKA
60 70 80 90 100
APLLKEEMAH HALLRESWEA AQETWEDKRR GLTLPPGFKA QNGIAIMVYT
110 120 130 140 150
NSSNTLYWEL NQAVRTGGGS RELYMRHFPF KALHFYLIRA LQLLRGSGGC
160 170 180 190 200
SRGPGEVVFR GVGSLRFEPK RLGDSVRLGQ FASSSLDKAV AHRFGNATLF
210 220 230 240 250
SLTTCFGAPI QAFSVFPKER EVLIPPHEVF LVTRFSQDGA QSLVTLWSYN
260 270 280 290
QTCSHFNCAY LGGEKRRGCV SAPGALGTGD LHMTKRHLQQ P
Length:291
Mass (Da):32,054
Last modified:May 18, 2010 - v4
Checksum:i9783A0473FB4613E
GO
Isoform 2 (identifier: Q96L15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     195-262: Missing.
     275-291: ALGTGDLHMTKRHLQQP → VQLGSQSEGASSLPPWKTLLLAPGEFQLSGVGP

Note: No experimental confirmation available.
Show »
Length:239
Mass (Da):25,963
Checksum:iBA4A6D7AB29A73BD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti43 – 431A → V in AAH14577 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241P → PT.4 Publications
Corresponds to variant rs72515796 [ dbSNP | Ensembl ].
VAR_063143

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei195 – 26268Missing in isoform 2. 1 PublicationVSP_013145Add
BLAST
Alternative sequencei275 – 29117ALGTG…HLQQP → VQLGSQSEGASSLPPWKTLL LAPGEFQLSGVGP in isoform 2. 1 PublicationVSP_013146Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16835 mRNA. Translation: CAC79987.1.
AY358466 mRNA. Translation: AAQ88831.1.
AC060812 Genomic DNA. No translation available.
CH471158 Genomic DNA. Translation: EAX02556.1.
BC014577 mRNA. Translation: AAH14577.1.
CCDSiCCDS73242.1. [Q96L15-2]
CCDS7743.1. [Q96L15-1]
RefSeqiNP_001073004.1. NM_001079536.1. [Q96L15-1]
NP_001284597.1. NM_001297668.1. [Q96L15-2]
NP_443750.2. NM_053017.4. [Q96L15-1]
UniGeneiHs.125680.

Genome annotation databases

EnsembliENST00000359918; ENSP00000352992; ENSG00000167311. [Q96L15-1]
ENST00000397067; ENSP00000380257; ENSG00000167311. [Q96L15-2]
ENST00000397068; ENSP00000380258; ENSG00000167311. [Q96L15-1]
GeneIDi116969.
KEGGihsa:116969.
UCSCiuc001lyb.2. human. [Q96L15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Y16835 mRNA. Translation: CAC79987.1.
AY358466 mRNA. Translation: AAQ88831.1.
AC060812 Genomic DNA. No translation available.
CH471158 Genomic DNA. Translation: EAX02556.1.
BC014577 mRNA. Translation: AAH14577.1.
CCDSiCCDS73242.1. [Q96L15-2]
CCDS7743.1. [Q96L15-1]
RefSeqiNP_001073004.1. NM_001079536.1. [Q96L15-1]
NP_001284597.1. NM_001297668.1. [Q96L15-2]
NP_443750.2. NM_053017.4. [Q96L15-1]
UniGeneiHs.125680.

3D structure databases

ProteinModelPortaliQ96L15.
SMRiQ96L15. Positions 26-260.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125545. 1 interaction.
STRINGi9606.ENSP00000352992.

Polymorphism and mutation databases

BioMutaiART5.
DMDMi296439487.

Proteomic databases

EPDiQ96L15.
PaxDbiQ96L15.
PeptideAtlasiQ96L15.
PRIDEiQ96L15.

Protocols and materials databases

DNASUi116969.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359918; ENSP00000352992; ENSG00000167311. [Q96L15-1]
ENST00000397067; ENSP00000380257; ENSG00000167311. [Q96L15-2]
ENST00000397068; ENSP00000380258; ENSG00000167311. [Q96L15-1]
GeneIDi116969.
KEGGihsa:116969.
UCSCiuc001lyb.2. human. [Q96L15-1]

Organism-specific databases

CTDi116969.
GeneCardsiART5.
H-InvDBHIX0009376.
HGNCiHGNC:24049. ART5.
HPAiHPA041637.
HPA044099.
MIMi610625. gene.
neXtProtiNX_Q96L15.
PharmGKBiPA134887713.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IVE0. Eukaryota.
ENOG4111WZG. LUCA.
GeneTreeiENSGT00530000062975.
HOGENOMiHOG000273888.
HOVERGENiHBG004464.
InParanoidiQ96L15.
KOiK19977.
OMAiRETVMAK.
PhylomeDBiQ96L15.
TreeFamiTF335356.

Miscellaneous databases

GenomeRNAii116969.
PROiQ96L15.
SOURCEiSearch...

Gene expression databases

BgeeiQ96L15.
CleanExiHS_ART5.
ExpressionAtlasiQ96L15. baseline and differential.
GenevisibleiQ96L15. HS.

Family and domain databases

InterProiIPR000768. ART.
[Graphical view]
PfamiPF01129. ART. 1 hit.
[Graphical view]
PRINTSiPR00970. RIBTRNSFRASE.
PROSITEiPS01291. ART. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse."
    Glowacki G., Braren R., Firner K., Nissen M., Kuehl M., Reche P., Bazan J.F., Cetkovic-Cvrlje M., Leiter E., Haag F., Koch-Nolte F.
    Protein Sci. 11:1657-1670(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-24 INS.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-24 INS.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-24 INS.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-24 INS.
    Tissue: Liver.
  6. "Toward a unified nomenclature for mammalian ADP-ribosyltransferases."
    Hottiger M.O., Hassa P.O., Luscher B., Schuler H., Koch-Nolte F.
    Trends Biochem. Sci. 35:208-219(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NOMENCLATURE.

Entry informationi

Entry nameiNAR5_HUMAN
AccessioniPrimary (citable) accession number: Q96L15
Secondary accession number(s): C9IYG7, Q6UX84, Q86W02
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 13, 2002
Last sequence update: May 18, 2010
Last modified: July 6, 2016
This is version 122 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.