Reviewed,
UniProtKB/Swiss-Prot Q96L15 (NAR5_HUMAN)
Last modified
January 19, 2010.
Version 70.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ecto-ADP-ribosyltransferase 5 EC=2.4.2.31 Alternative name(s): NAD(P)(+)--arginine ADP-ribosyltransferase 5 Mono(ADP-ribosyl)transferase 5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 292 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Catalytic activity | NAD+ + protein-L-arginine = nicotinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine. NADP+ + protein-L-arginine = nicotinamide + N(omega)-((2'-phospho-ADP)-D-ribosyl)-protein-L-arginine. |
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the Arg-specific ADP-ribosyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Ligand | NAD NADP |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | NAD(P)+-protein-arginine ADP-ribosyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96L15-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96L15-2) The sequence of this isoform differs from the canonical sequence as follows: 196-263: Missing. 276-292: ALGTGDLHMTKRHLQQP → VQLGSQSEGASSLPPWKTLLLAPGEFQLSGVGP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||
| Chain | 23 – 292 | 270 | Ecto-ADP-ribosyltransferase 5 | PRO_0000019333 | |||||||
Sites | |||||||||||
| Active site | 229 | 1 | By similarity | ||||||||
| Binding site | 100 | 1 | NAD By similarity | ||||||||
| Binding site | 161 | 1 | NAD By similarity | ||||||||
| Binding site | 181 | 1 | NAD By similarity | ||||||||
| Binding site | 215 | 1 | NAD By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 102 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 197 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 251 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 43 ↔ 259 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 196 – 263 | 68 | Missing in isoform 2. | VSP_013145 | |||||||
| Alternative sequence | 276 – 292 | 17 | ALGTG…HLQQP → VQLGSQSEGASSLPPWKTLL LAPGEFQLSGVGP in isoform 2. | VSP_013146 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 44 | 1 | A → V in AAH14577. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse." Glowacki G., Braren R., Firner K., Nissen M., Kuehl M., Reche P., Bazan J.F., Cetkovic-Cvrlje M., Leiter E., Haag F., Koch-Nolte F. Protein Sci. 11:1657-1670(2002) [PubMed: 12070318] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y16835 mRNA. Translation: CAC79987.1. AY358466 mRNA. Translation: AAQ88831.1. CH471158 Genomic DNA. Translation: EAX02556.1. BC014577 mRNA. Translation: AAH14577.1. |
| IPI | IPI00328943. IPI00432414. |
| RefSeq | NP_001073004.1. NP_443750.2. |
| UniGene | Hs.125680 |
3D structure databases | |
| SMR | Q96L15. Positions 27-261. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96L15. |
Proteomic databases | |
| PRIDE | Q96L15. |
Genome annotation databases | |
| Ensembl | ENST00000359918; ENSP00000352992; ENSG00000167311; Homo sapiens. [Genome view] ENST00000397068; ENSP00000380258; ENSG00000167311; Homo sapiens. [Genome view] |
| GeneID | 116969. |
| KEGG | hsa:116969. |
| UCSC | uc001lyd.2. human. |
Organism-specific databases | |
| CTD | 116969. |
| GeneCards | GC11M003616. |
| HGNC | HGNC:24049. ART5. |
| MIM | 610625. gene. |
| PharmGKB | PA134887713. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04603. |
| HOGENOM | HBG443999. |
| HOVERGEN | Q96L15. |
| InParanoid | Q96L15. |
Enzyme and pathway databases | |
| BRENDA | 2.4.2.31. 247. |
Gene expression databases | |
| ArrayExpress | Q96L15. |
| Bgee | Q96L15. |
| CleanEx | HS_ART5. |
| Genevestigator | Q96L15. |
| GermOnline | ENSG00000167311. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000768. ART. [Graphical view] |
| PANTHER | PTHR10339. ART. 1 hit. |
| Pfam | PF01129. ART. 1 hit. [Graphical view] |
| PRINTS | PR00970. RIBTRNSFRASE. |
| PROSITE | PS01291. ART. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 80046. |
| SOURCE | Search... |
Entry information
| Entry name | NAR5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96L15 Secondary accession number(s): Q6UX84, Q86W02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


