Q96L15 (NAR5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ecto-ADP-ribosyltransferase 5 EC=2.4.2.31 Alternative name(s): Mono(ADP-ribosyl)transferase 5 NAD(P)(+)--arginine ADP-ribosyltransferase 5 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 291 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Catalytic activity | NAD+ + protein-L-arginine = nicotinamide + N(omega)-(ADP-D-ribosyl)-protein-L-arginine. NADP+ + protein-L-arginine = nicotinamide + N(omega)-((2'-phospho-ADP)-D-ribosyl)-protein-L-arginine. |
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the Arg-specific ADP-ribosyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Ligand | NAD NADP |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | protein ADP-ribosylation Inferred from electronic annotation. Source: InterPro |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | NAD(P)+-protein-arginine ADP-ribosyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96L15-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96L15-2) The sequence of this isoform differs from the canonical sequence as follows: 195-262: Missing. 275-291: ALGTGDLHMTKRHLQQP → VQLGSQSEGASSLPPWKTLLLAPGEFQLSGVGP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||
| Chain | 23 – 291 | 269 | Ecto-ADP-ribosyltransferase 5 | PRO_0000019333 | |||||||
Sites | |||||||||||
| Active site | 228 | 1 | By similarity | ||||||||
| Binding site | 99 | 1 | NAD By similarity | ||||||||
| Binding site | 160 | 1 | NAD By similarity | ||||||||
| Binding site | 180 | 1 | NAD By similarity | ||||||||
| Binding site | 214 | 1 | NAD By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 101 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 196 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 250 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 42 ↔ 258 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 195 – 262 | 68 | Missing in isoform 2. | VSP_013145 | |||||||
| Alternative sequence | 275 – 291 | 17 | ALGTG…HLQQP → VQLGSQSEGASSLPPWKTLL LAPGEFQLSGVGP in isoform 2. | VSP_013146 | |||||||
| Natural variant | 24 | 1 | P → PT. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs72515796 [ dbSNP | Ensembl ]. | VAR_063143 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 43 | 1 | A → V in AAH14577. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The family of toxin-related ecto-ADP-ribosyltransferases in humans and the mouse." Glowacki G., Braren R., Firner K., Nissen M., Kuehl M., Reche P., Bazan J.F., Cetkovic-Cvrlje M., Leiter E., Haag F., Koch-Nolte F. Protein Sci. 11:1657-1670(2002) [PubMed: 12070318] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-24 INS. Tissue: Testis. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT THR-24 INS. |
| [3] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed: 16554811] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT THR-24 INS. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-24 INS. Tissue: Liver. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | Y16835 mRNA. Translation: CAC79987.1. AY358466 mRNA. Translation: AAQ88831.1. AC060812 Genomic DNA. No translation available. CH471158 Genomic DNA. Translation: EAX02556.1. BC014577 mRNA. Translation: AAH14577.1. |
| IPI | IPI00328943. IPI00432414. |
| RefSeq | NP_001073004.1. NM_001079536.1. NP_443750.2. NM_053017.3. |
| UniGene | Hs.125680. |
3D structure databases | |
| ProteinModelPortal | Q96L15. |
| SMR | Q96L15. Positions 26-260. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96L15. |
Polymorphism databases | |
| DMDM | 296439487. |
Proteomic databases | |
| PRIDE | Q96L15. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000359918; ENSP00000352992; ENSG00000167311. ENST00000397068; ENSP00000380258; ENSG00000167311. |
| GeneID | 116969. |
| KEGG | hsa:116969. |
| UCSC | uc001lyd.2. human. |
Organism-specific databases | |
| CTD | 116969. |
| GeneCards | GC11M003659. |
| HGNC | HGNC:24049. ART5. |
| MIM | 610625. gene. |
| neXtProt | NX_Q96L15. |
| PharmGKB | PA134887713. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04603. |
| GeneTree | ENSGT00530000062975. |
| HOGENOM | HBG443999. |
| HOVERGEN | HBG004464. |
| InParanoid | Q96L15. |
| OMA | LHFEPKR. |
| OrthoDB | EOG4V1719. |
| PhylomeDB | Q96L15. |
Gene expression databases | |
| ArrayExpress | Q96L15. |
| Bgee | Q96L15. |
| CleanEx | HS_ART5. |
| Genevestigator | Q96L15. |
| GermOnline | ENSG00000167311. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000768. ART. [Graphical view] |
| KO | K00775. |
| PANTHER | PTHR10339. ART. 1 hit. |
| Pfam | PF01129. ART. 1 hit. [Graphical view] |
| PRINTS | PR00970. RIBTRNSFRASE. |
| PROSITE | PS01291. ART. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 80046. |
| SOURCE | Search... |
Entry information
| Entry name | NAR5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96L15 Secondary accession number(s): C9IYG7, Q6UX84, Q86W02 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with