SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96KV7

- WDR90_HUMAN

UniProt

Q96KV7 - WDR90_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

WD repeat-containing protein 90

Gene
WDR90, C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, KIAA1924
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ96KV7.

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 90
Gene namesi
Name:WDR90
Synonyms:C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, KIAA1924
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:26960. WDR90.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145147652.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 17481748WD repeat-containing protein 90PRO_0000341412Add
BLAST

Proteomic databases

PaxDbiQ96KV7.
PRIDEiQ96KV7.

PTM databases

PhosphoSiteiQ96KV7.

Expressioni

Gene expression databases

ArrayExpressiQ96KV7.
BgeeiQ96KV7.
CleanExiHS_WDR90.
GenevestigatoriQ96KV7.

Organism-specific databases

HPAiHPA049362.

Structurei

3D structure databases

ProteinModelPortaliQ96KV7.
SMRiQ96KV7. Positions 633-1644, 1659-1689.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati407 – 45044WD 1Add
BLAST
Repeati452 – 49443WD 2Add
BLAST
Repeati501 – 54141WD 3Add
BLAST
Repeati615 – 65440WD 4Add
BLAST
Repeati656 – 69540WD 5Add
BLAST
Repeati698 – 73740WD 6Add
BLAST
Repeati740 – 77940WD 7Add
BLAST
Repeati782 – 82140WD 8Add
BLAST
Repeati882 – 92241WD 9Add
BLAST
Repeati926 – 96439WD 10Add
BLAST
Repeati969 – 100941WD 11Add
BLAST
Repeati1156 – 120146WD 12Add
BLAST
Repeati1204 – 124542WD 13Add
BLAST
Repeati1247 – 128640WD 14Add
BLAST
Repeati1298 – 132629WD 15Add
BLAST
Repeati1327 – 137650WD 16Add
BLAST
Repeati1433 – 147240WD 17Add
BLAST
Repeati1475 – 152046WD 18Add
BLAST
Repeati1523 – 156240WD 19Add
BLAST
Repeati1568 – 161447WD 20Add
BLAST
Repeati1715 – 174834WD 21Add
BLAST

Sequence similaritiesi

Contains 21 WD repeats.

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiCOG2319.
HOVERGENiHBG108675.
InParanoidiQ96KV7.
PhylomeDBiQ96KV7.
TreeFamiTF329419.

Family and domain databases

Gene3Di2.130.10.10. 5 hits.
InterProiIPR007714. DUF667.
IPR021717. Nucleoporin_Nup160.
IPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF05018. DUF667. 1 hit.
PF11715. Nup160. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00320. WD40. 20 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 3 hits.
SSF50998. SSF50998. 5 hits.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96KV7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MARAWQHPFL NVFRHFRVDE WKRSAKQGDV AVVTDKTLKG AVYRIRGSVS     50
AANYIQLPKS STQSLGLTGR YLYVLFRPLP SKHFVIHLDV SSKDNQVIRV 100
SFSNLFKEFK STATWLQFPL VLEARTPQRD LVGLAPSGAR WTCLQLDLQD 150
VLLVYLNRCY GHLKSIRLCA SLLVRNLYTS DLCFEPAISG AQWAKLPVTP 200
MPREMAFPVP KGESWHDRYI HVRFPSESLK VPSKPIEKSC SPPEAVLLGP 250
GPQPLPCPVA SSKPVRFSVS PVVQTPSPTA SGRAALAPRP FPEVSLSQER 300
SDASNADGPG FHSLEPWAQL EASDIHTAAA GTHVLTHESA EVPVARTGSC 350
EGFLPDPVLR LKGVIGFGGH GTRQALWTPD GAAVVYPCHA VIVVLLVDTG 400
EQRFFLGHTD KVSALALDGS SSLLASAQAR APSVMRLWDF QTGRCLCLFR 450
SPMHVVCSLS FSDSGALLCG VGKDHHGRTM VVAWGTGQVG LGGEVVVLAK 500
AHTDFDVQAF RVTFFDETRM ASCGQGSVRL WRLRGGVLRS CPVDLGEHHA 550
LQFTDLAFKQ ARDGCPEPSA AMLFVCSRSG HILEIDCQRM VVRHARRLLP 600
TRTPGGPHPQ KQTFSSGPGI AISSLSVSPA MCAVGSEDGF LRLWPLDFSS 650
VLLEAEHEGP VSSVCVSPDG LRVLSATSSG HLGFLDTLSR VYHMLARSHT 700
APVLALAMEQ RRGQLATVSQ DRTVRIWDLA TLQQLYDFTS SEDAPCAVTF 750
HPTRPTFFCG FSSGAVRSFS LEAAEVLVEH TCHRGAVTGL TATPDGRLLF 800
SSCSQGSLAQ YSCADPQWHV LRVAADMVCP DAPASPSALA VSRDGRLLAF 850
VGPSRCTVTV MGSASLDELL RVDIGTLDLA SSRLDSAMAV CFGPAALGHL 900
LVSTSSNRVV VLDAVSGRII RELPGVHPEP CPSLTLSEDA RFLLIAAGRT 950
IKVWDYATQA SPGPQVYIGH SEPVQAVAFS PDQQQVLSAG DAVFLWDVLA 1000
PTESDQSFPG APPACKTGPG AGPLEDAASR ASELPRQQVP KPCQASPPRL 1050
GVCARPPEGG DGARDTRNSG APRTTYLASC KAFTPARVSC SPHSAKGTCP 1100
PPASGGWLRL KAVVGYSGNG RANMVWRPDT GFFAYTCGRL VVVEDLHSGA 1150
QQHWSGHSAE ISTLALSHSA QVLASASGRS STTAHCQIRV WDVSGGLCQH 1200
LIFPHSTTVL ALAFSPDDRL LVTLGDHDGR TLALWGTATY DLVSSTRLPE 1250
PVHGVAFNPW DAGELTCVGQ GTVTFWLLQQ RGADISLQVR REPVPEAVGA 1300
GELTSLCYGA PPLLYCGTSS GQVCVWDTRA GRCFLSWEAD DGGIGLLLFS 1350
GSRLVSGSST GRLRLWAVGA VSELRCKGSG ASSVFMEHEL VLDGAVVSAS 1400
FDDSVDMGVV GTTAGTLWFV SWAEGTSTRL ISGHRSKVNE VVFSPGESHC 1450
ATCSEDGSVR VWALASMELV IQFQVLNQSC LCLAWSPPCC GRPEQQRLAA 1500
GYGDGSLRIF SVSRTAMELK MHPHPVALTT VAFSTDGQTV LSGDKDGLVA 1550
VSHPCTGTTF RVLSDHQGAP ISTICVTCKE CEDLGVEGTD LWLAASGDQR 1600
VSVWASDWLR NHCELVDWLS FPMPATTETQ GHLPPSLAAF CPWDGALLMY 1650
VGPGVYKEVI IYNLCQKQVV EKIPLPFFAM SLSLSPGTHL LAVGFAECML 1700
RLVDCAMGTA QDFAGHDNAV HLCRFTPSAR LLFTAARNEI LVWEVPGL 1748

Note: Gene prediction based on partial mRNA and EST data.

Length:1,748
Mass (Da):187,437
Last modified:June 10, 2008 - v2
Checksum:iB9FC77D5F0FAAD9D
GO
Isoform 2 (identifier: Q96KV7-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1629-1672: TQGHLPPSLA...NLCQKQVVEK → VNHAPGTVGG...LPSALGMGRS
     1673-1748: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. Ref.1 (BAC04205) sequence differs from that shown at position 252 due to erroneous termination.

Show »
Length:271
Mass (Da):29,372
Checksum:i6680E355BF7B99A1
GO
Isoform 3 (identifier: Q96KV7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.

Note: No experimental confirmation available.

Show »
Length:708
Mass (Da):76,977
Checksum:iA171E6E92EDC81D7
GO
Isoform 4 (identifier: Q96KV7-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1580-1627: Missing.

Note: No experimental confirmation available.

Show »
Length:299
Mass (Da):32,434
Checksum:i48227B6EB6DAC52C
GO
Isoform 5 (identifier: Q96KV7-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     280-280: A → AQ
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.

Note: No experimental confirmation available.

Show »
Length:709
Mass (Da):77,106
Checksum:iF65276B3F8EF49A6
GO

Sequence cautioni

The sequence BAB67817.1 differs from that shown. Reason: Intron retention.
The sequence BAC03575.1 differs from that shown. Reason: Unlikely isoform. Aberrant splicing.
The sequence BAC04225.1 differs from that shown. Reason: Probable cloning artifact.
The sequence BAD18654.1 differs from that shown. Reason: Probable cloning artifact.
Isoform 3 : The sequence AAI21187.1 differs from that shown. Reason: Frameshift at position 697.
Isoform 5 : The sequence AAI21186.1 differs from that shown. Reason: Frameshift at position 697.
The sequence BAC04225.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAK61239.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence EAW85775.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti165 – 1651S → T.3 Publications
Corresponds to variant rs13337278 [ dbSNP | Ensembl ].
VAR_044060
Natural varianti250 – 2501P → L.1 Publication
Corresponds to variant rs11642546 [ dbSNP | Ensembl ].
VAR_044061
Natural varianti537 – 5371V → A.1 Publication
Corresponds to variant rs3803697 [ dbSNP | Ensembl ].
VAR_044062
Natural varianti1001 – 10011P → T.1 Publication
Corresponds to variant rs4984906 [ dbSNP | Ensembl ].
VAR_044063
Natural varianti1492 – 14921R → H.
Corresponds to variant rs7190775 [ dbSNP | Ensembl ].
VAR_044064
Natural varianti1555 – 15551C → R.
Corresponds to variant rs11866949 [ dbSNP | Ensembl ].
VAR_044065

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 14011401Missing in isoform 2 and isoform 4. VSP_034290Add
BLAST
Alternative sequencei280 – 2801A → AQ in isoform 5. VSP_034294
Alternative sequencei656 – 70853EHEGP…LALAM → GDAVGTLSQLPESLAWMLGR GRPSPRGSAVSRPGSWLHRV PRGQVAYPEPWGG in isoform 3 and isoform 5. VSP_034298Add
BLAST
Alternative sequencei709 – 17481040Missing in isoform 3 and isoform 5. VSP_034300Add
BLAST
Alternative sequencei1402 – 143736DDSVD…GHRSK → MLWFGQPGPGGWNRKCLRPF TLPRGQHPQPSYGFPQ in isoform 2 and isoform 4. VSP_034303Add
BLAST
Alternative sequencei1580 – 162748Missing in isoform 4. VSP_034306Add
BLAST
Alternative sequencei1629 – 167244TQGHL…QVVEK → VNHAPGTVGGAGTHPPHRSM LRLCRLRATWHPPSLPSALG MGRS in isoform 2. VSP_041087Add
BLAST
Alternative sequencei1673 – 174876Missing in isoform 2. VSP_041088Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti899 – 8991H → Q in BAD18654. 1 Publication
Sequence conflicti1085 – 10851P → L in BAD18654. 1 Publication
Sequence conflicti1245 – 12451S → P in BAC04225. 1 Publication
Sequence conflicti1302 – 13021E → G in BAC04225. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK091062 mRNA. Translation: BAC03575.1. Sequence problems.
AK093609 mRNA. Translation: BAC04205.1. Sequence problems.
AK093802 mRNA. Translation: BAC04225.1. Sequence problems.
AK131510 mRNA. Translation: BAD18654.1. Sequence problems.
AE006464 Genomic DNA. Translation: AAK61239.1. Sequence problems.
AL022341 Genomic DNA. Translation: CAC79469.1.
Z92544 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85775.1. Sequence problems.
BC065836 mRNA. Translation: AAH65836.1.
BC121185 mRNA. Translation: AAI21186.1. Frameshift.
BC121186 mRNA. Translation: AAI21187.1. Frameshift.
AB067511 mRNA. Translation: BAB67817.1. Sequence problems.
CCDSiCCDS42092.1. [Q96KV7-1]
RefSeqiNP_660337.3. NM_145294.4. [Q96KV7-1]
UniGeneiHs.511903.

Genome annotation databases

EnsembliENST00000293879; ENSP00000293879; ENSG00000161996. [Q96KV7-1]
ENST00000315764; ENSP00000322808; ENSG00000161996. [Q96KV7-7]
GeneIDi197335.
KEGGihsa:197335.
UCSCiuc002cig.1. human. [Q96KV7-3]
uc002cih.1. human. [Q96KV7-5]
uc002cii.1. human. [Q96KV7-1]
uc010bqx.1. human. [Q96KV7-7]

Polymorphism databases

DMDMi190423649.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK091062 mRNA. Translation: BAC03575.1 . Sequence problems.
AK093609 mRNA. Translation: BAC04205.1 . Sequence problems.
AK093802 mRNA. Translation: BAC04225.1 . Sequence problems.
AK131510 mRNA. Translation: BAD18654.1 . Sequence problems.
AE006464 Genomic DNA. Translation: AAK61239.1 . Sequence problems.
AL022341 Genomic DNA. Translation: CAC79469.1 .
Z92544 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85775.1 . Sequence problems.
BC065836 mRNA. Translation: AAH65836.1 .
BC121185 mRNA. Translation: AAI21186.1 . Frameshift.
BC121186 mRNA. Translation: AAI21187.1 . Frameshift.
AB067511 mRNA. Translation: BAB67817.1 . Sequence problems.
CCDSi CCDS42092.1. [Q96KV7-1 ]
RefSeqi NP_660337.3. NM_145294.4. [Q96KV7-1 ]
UniGenei Hs.511903.

3D structure databases

ProteinModelPortali Q96KV7.
SMRi Q96KV7. Positions 633-1644, 1659-1689.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q96KV7.

Polymorphism databases

DMDMi 190423649.

Proteomic databases

PaxDbi Q96KV7.
PRIDEi Q96KV7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000293879 ; ENSP00000293879 ; ENSG00000161996 . [Q96KV7-1 ]
ENST00000315764 ; ENSP00000322808 ; ENSG00000161996 . [Q96KV7-7 ]
GeneIDi 197335.
KEGGi hsa:197335.
UCSCi uc002cig.1. human. [Q96KV7-3 ]
uc002cih.1. human. [Q96KV7-5 ]
uc002cii.1. human. [Q96KV7-1 ]
uc010bqx.1. human. [Q96KV7-7 ]

Organism-specific databases

CTDi 197335.
GeneCardsi GC16P000699.
H-InvDB HIX0012659.
HGNCi HGNC:26960. WDR90.
HPAi HPA049362.
neXtProti NX_Q96KV7.
PharmGKBi PA145147652.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2319.
HOVERGENi HBG108675.
InParanoidi Q96KV7.
PhylomeDBi Q96KV7.
TreeFami TF329419.

Enzyme and pathway databases

SignaLinki Q96KV7.

Miscellaneous databases

ChiTaRSi WDR90. human.
GenomeRNAii 197335.
NextBioi 89648.
PROi Q96KV7.

Gene expression databases

ArrayExpressi Q96KV7.
Bgeei Q96KV7.
CleanExi HS_WDR90.
Genevestigatori Q96KV7.

Family and domain databases

Gene3Di 2.130.10.10. 5 hits.
InterProi IPR007714. DUF667.
IPR021717. Nucleoporin_Nup160.
IPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view ]
Pfami PF05018. DUF667. 1 hit.
PF11715. Nup160. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view ]
SMARTi SM00320. WD40. 20 hits.
[Graphical view ]
SUPFAMi SSF50978. SSF50978. 3 hits.
SSF50998. SSF50998. 5 hits.
PROSITEi PS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS THR-165 AND THR-1001.
    Tissue: Cerebellum, Thymus and Uterus.
  2. "Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16."
    Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R.
    Hum. Mol. Genet. 10:339-352(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANTS THR-165; LEU-250 AND ALA-537.
    Tissue: Brain.
  6. "Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
    Nagase T., Kikuno R., Ohara O.
    DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1138 (ISOFORM 1), VARIANT THR-165.
    Tissue: Brain.

Entry informationi

Entry nameiWDR90_HUMAN
AccessioniPrimary (citable) accession number: Q96KV7
Secondary accession number(s): Q0VA87
, Q0VA88, Q6P048, Q6ZMS1, Q6ZTH1, Q8N202, Q8N221, Q8NBB8, Q96PW4, Q96S18
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: July 9, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi