Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96KV7 (WDR90_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
WD repeat-containing protein 90
Gene names
Name:WDR90
Synonyms:C16orf15, C16orf16, C16orf17, C16orf18, C16orf19, KIAA1924
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1748 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Contains 21 WD repeats.

Sequence caution

The sequence AAK61239.1 differs from that shown. Reason: Erroneous gene model prediction.

The sequence BAB67817.1 differs from that shown. Reason: Intron retention.

The sequence BAC03575.1 differs from that shown. Reason: Unlikely isoform. Aberrant splicing.

The sequence BAC04225.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAC04225.1 differs from that shown. Reason: Probable cloning artifact.

The sequence BAD18654.1 differs from that shown. Reason: Probable cloning artifact.

The sequence EAW85775.1 differs from that shown. Reason: Erroneous gene model prediction.

Isoform 3: The sequence AAI21187.1 differs from that shown. Reason: Frameshift at position 697.

Isoform 5: The sequence AAI21186.1 differs from that shown. Reason: Frameshift at position 697.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
WD repeat
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96KV7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Gene prediction based on partial mRNA and EST data.
Isoform 2 (identifier: Q96KV7-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1629-1672: TQGHLPPSLA...NLCQKQVVEK → VNHAPGTVGG...LPSALGMGRS
     1673-1748: Missing.
Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. Ref.1 (BAC04205) sequence differs from that shown at position 252 due to erroneous termination.
Isoform 3 (identifier: Q96KV7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96KV7-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1401: Missing.
     1402-1437: DDSVDMGVVGTTAGTLWFVSWAEGTSTRLISGHRSK → MLWFGQPGPGGWNRKCLRPFTLPRGQHPQPSYGFPQ
     1580-1627: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q96KV7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     280-280: A → AQ
     656-708: EHEGPVSSVC...HTAPVLALAM → GDAVGTLSQL...QVAYPEPWGG
     709-1748: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 17481748WD repeat-containing protein 90
PRO_0000341412

Regions

Repeat407 – 45044WD 1
Repeat452 – 49443WD 2
Repeat501 – 54141WD 3
Repeat615 – 65440WD 4
Repeat656 – 69540WD 5
Repeat698 – 73740WD 6
Repeat740 – 77940WD 7
Repeat782 – 82140WD 8
Repeat882 – 92241WD 9
Repeat926 – 96439WD 10
Repeat969 – 100941WD 11
Repeat1156 – 120146WD 12
Repeat1204 – 124542WD 13
Repeat1247 – 128640WD 14
Repeat1298 – 132629WD 15
Repeat1327 – 137650WD 16
Repeat1433 – 147240WD 17
Repeat1475 – 152046WD 18
Repeat1523 – 156240WD 19
Repeat1568 – 161447WD 20
Repeat1715 – 174834WD 21

Natural variations

Alternative sequence1 – 14011401Missing in isoform 2 and isoform 4.
VSP_034290
Alternative sequence2801A → AQ in isoform 5.
VSP_034294
Alternative sequence656 – 70853EHEGP…LALAM → GDAVGTLSQLPESLAWMLGR GRPSPRGSAVSRPGSWLHRV PRGQVAYPEPWGG in isoform 3 and isoform 5.
VSP_034298
Alternative sequence709 – 17481040Missing in isoform 3 and isoform 5.
VSP_034300
Alternative sequence1402 – 143736DDSVD…GHRSK → MLWFGQPGPGGWNRKCLRPF TLPRGQHPQPSYGFPQ in isoform 2 and isoform 4.
VSP_034303
Alternative sequence1580 – 162748Missing in isoform 4.
VSP_034306
Alternative sequence1629 – 167244TQGHL…QVVEK → VNHAPGTVGGAGTHPPHRSM LRLCRLRATWHPPSLPSALG MGRS in isoform 2.
VSP_041087
Alternative sequence1673 – 174876Missing in isoform 2.
VSP_041088
Natural variant1651S → T. Ref.1 Ref.5 Ref.6
Corresponds to variant rs13337278 [ dbSNP | Ensembl ].
VAR_044060
Natural variant2501P → L. Ref.5
Corresponds to variant rs11642546 [ dbSNP | Ensembl ].
VAR_044061
Natural variant5371V → A. Ref.5
Corresponds to variant rs3803697 [ dbSNP | Ensembl ].
VAR_044062
Natural variant10011P → T. Ref.1
Corresponds to variant rs4984906 [ dbSNP | Ensembl ].
VAR_044063
Natural variant14921R → H.
Corresponds to variant rs7190775 [ dbSNP | Ensembl ].
VAR_044064
Natural variant15551C → R.
Corresponds to variant rs11866949 [ dbSNP | Ensembl ].
VAR_044065

Experimental info

Sequence conflict8991H → Q in BAD18654. Ref.1
Sequence conflict10851P → L in BAD18654. Ref.1
Sequence conflict12451S → P in BAC04225. Ref.1
Sequence conflict13021E → G in BAC04225. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 10, 2008. Version 2.
Checksum: B9FC77D5F0FAAD9D

FASTA1,748187,437
        10         20         30         40         50         60 
MARAWQHPFL NVFRHFRVDE WKRSAKQGDV AVVTDKTLKG AVYRIRGSVS AANYIQLPKS 

        70         80         90        100        110        120 
STQSLGLTGR YLYVLFRPLP SKHFVIHLDV SSKDNQVIRV SFSNLFKEFK STATWLQFPL 

       130        140        150        160        170        180 
VLEARTPQRD LVGLAPSGAR WTCLQLDLQD VLLVYLNRCY GHLKSIRLCA SLLVRNLYTS 

       190        200        210        220        230        240 
DLCFEPAISG AQWAKLPVTP MPREMAFPVP KGESWHDRYI HVRFPSESLK VPSKPIEKSC 

       250        260        270        280        290        300 
SPPEAVLLGP GPQPLPCPVA SSKPVRFSVS PVVQTPSPTA SGRAALAPRP FPEVSLSQER 

       310        320        330        340        350        360 
SDASNADGPG FHSLEPWAQL EASDIHTAAA GTHVLTHESA EVPVARTGSC EGFLPDPVLR 

       370        380        390        400        410        420 
LKGVIGFGGH GTRQALWTPD GAAVVYPCHA VIVVLLVDTG EQRFFLGHTD KVSALALDGS 

       430        440        450        460        470        480 
SSLLASAQAR APSVMRLWDF QTGRCLCLFR SPMHVVCSLS FSDSGALLCG VGKDHHGRTM 

       490        500        510        520        530        540 
VVAWGTGQVG LGGEVVVLAK AHTDFDVQAF RVTFFDETRM ASCGQGSVRL WRLRGGVLRS 

       550        560        570        580        590        600 
CPVDLGEHHA LQFTDLAFKQ ARDGCPEPSA AMLFVCSRSG HILEIDCQRM VVRHARRLLP 

       610        620        630        640        650        660 
TRTPGGPHPQ KQTFSSGPGI AISSLSVSPA MCAVGSEDGF LRLWPLDFSS VLLEAEHEGP 

       670        680        690        700        710        720 
VSSVCVSPDG LRVLSATSSG HLGFLDTLSR VYHMLARSHT APVLALAMEQ RRGQLATVSQ 

       730        740        750        760        770        780 
DRTVRIWDLA TLQQLYDFTS SEDAPCAVTF HPTRPTFFCG FSSGAVRSFS LEAAEVLVEH 

       790        800        810        820        830        840 
TCHRGAVTGL TATPDGRLLF SSCSQGSLAQ YSCADPQWHV LRVAADMVCP DAPASPSALA 

       850        860        870        880        890        900 
VSRDGRLLAF VGPSRCTVTV MGSASLDELL RVDIGTLDLA SSRLDSAMAV CFGPAALGHL 

       910        920        930        940        950        960 
LVSTSSNRVV VLDAVSGRII RELPGVHPEP CPSLTLSEDA RFLLIAAGRT IKVWDYATQA 

       970        980        990       1000       1010       1020 
SPGPQVYIGH SEPVQAVAFS PDQQQVLSAG DAVFLWDVLA PTESDQSFPG APPACKTGPG 

      1030       1040       1050       1060       1070       1080 
AGPLEDAASR ASELPRQQVP KPCQASPPRL GVCARPPEGG DGARDTRNSG APRTTYLASC 

      1090       1100       1110       1120       1130       1140 
KAFTPARVSC SPHSAKGTCP PPASGGWLRL KAVVGYSGNG RANMVWRPDT GFFAYTCGRL 

      1150       1160       1170       1180       1190       1200 
VVVEDLHSGA QQHWSGHSAE ISTLALSHSA QVLASASGRS STTAHCQIRV WDVSGGLCQH 

      1210       1220       1230       1240       1250       1260 
LIFPHSTTVL ALAFSPDDRL LVTLGDHDGR TLALWGTATY DLVSSTRLPE PVHGVAFNPW 

      1270       1280       1290       1300       1310       1320 
DAGELTCVGQ GTVTFWLLQQ RGADISLQVR REPVPEAVGA GELTSLCYGA PPLLYCGTSS 

      1330       1340       1350       1360       1370       1380 
GQVCVWDTRA GRCFLSWEAD DGGIGLLLFS GSRLVSGSST GRLRLWAVGA VSELRCKGSG 

      1390       1400       1410       1420       1430       1440 
ASSVFMEHEL VLDGAVVSAS FDDSVDMGVV GTTAGTLWFV SWAEGTSTRL ISGHRSKVNE 

      1450       1460       1470       1480       1490       1500 
VVFSPGESHC ATCSEDGSVR VWALASMELV IQFQVLNQSC LCLAWSPPCC GRPEQQRLAA 

      1510       1520       1530       1540       1550       1560 
GYGDGSLRIF SVSRTAMELK MHPHPVALTT VAFSTDGQTV LSGDKDGLVA VSHPCTGTTF 

      1570       1580       1590       1600       1610       1620 
RVLSDHQGAP ISTICVTCKE CEDLGVEGTD LWLAASGDQR VSVWASDWLR NHCELVDWLS 

      1630       1640       1650       1660       1670       1680 
FPMPATTETQ GHLPPSLAAF CPWDGALLMY VGPGVYKEVI IYNLCQKQVV EKIPLPFFAM 

      1690       1700       1710       1720       1730       1740 
SLSLSPGTHL LAVGFAECML RLVDCAMGTA QDFAGHDNAV HLCRFTPSAR LLFTAARNEI 


LVWEVPGL 

« Hide

Isoform 2 [UniParc].

Checksum: 6680E355BF7B99A1
Show »

FASTA27129,372
Isoform 3 [UniParc].

Checksum: A171E6E92EDC81D7
Show »

FASTA70876,977
Isoform 4 [UniParc].

Checksum: 48227B6EB6DAC52C
Show »

FASTA29932,434
Isoform 5 [UniParc].

Checksum: F65276B3F8EF49A6
Show »

FASTA70977,106

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS THR-165 AND THR-1001.
Tissue: Cerebellum, Thymus and Uterus.
[2]"Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16."
Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R.
Hum. Mol. Genet. 10:339-352(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5), VARIANTS THR-165; LEU-250 AND ALA-537.
Tissue: Brain.
[6]"Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins."
Nagase T., Kikuno R., Ohara O.
DNA Res. 8:179-187(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-1138 (ISOFORM 1), VARIANT THR-165.
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK091062 mRNA. Translation: BAC03575.1. Sequence problems.
AK093609 mRNA. Translation: BAC04205.1. Sequence problems.
AK093802 mRNA. Translation: BAC04225.1. Sequence problems.
AK131510 mRNA. Translation: BAD18654.1. Sequence problems.
AE006464 Genomic DNA. Translation: AAK61239.1. Sequence problems.
AL022341 Genomic DNA. Translation: CAC79469.1.
Z92544 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85775.1. Sequence problems.
BC065836 mRNA. Translation: AAH65836.1.
BC121185 mRNA. Translation: AAI21186.1. Frameshift.
BC121186 mRNA. Translation: AAI21187.1. Frameshift.
AB067511 mRNA. Translation: BAB67817.1. Sequence problems.
RefSeqNP_660337.3. NM_145294.4.
UniGeneHs.511903.

3D structure databases

ProteinModelPortalQ96KV7.
SMRQ96KV7. Positions 633-1644.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ96KV7.

Polymorphism databases

DMDM190423649.

Proteomic databases

PaxDbQ96KV7.
PRIDEQ96KV7.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000293879; ENSP00000293879; ENSG00000161996. [Q96KV7-1]
ENST00000315764; ENSP00000322808; ENSG00000161996. [Q96KV7-7]
GeneID197335.
KEGGhsa:197335.
UCSCuc002cig.1. human. [Q96KV7-3]
uc002cih.1. human. [Q96KV7-5]
uc002cii.1. human. [Q96KV7-1]
uc010bqx.1. human. [Q96KV7-7]

Organism-specific databases

CTD197335.
GeneCardsGC16P000699.
H-InvDBHIX0012659.
HGNCHGNC:26960. WDR90.
HPAHPA049362.
neXtProtNX_Q96KV7.
PharmGKBPA145147652.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2319.
HOVERGENHBG108675.
InParanoidQ96KV7.
PhylomeDBQ96KV7.
TreeFamTF329419.

Enzyme and pathway databases

SignaLinkQ96KV7.

Gene expression databases

ArrayExpressQ96KV7.
BgeeQ96KV7.
CleanExHS_WDR90.
GenevestigatorQ96KV7.

Family and domain databases

Gene3D2.130.10.10. 5 hits.
InterProIPR007714. DUF667.
IPR021717. Nucleoporin_Nup160.
IPR011047. Quinonprotein_ADH-like_supfam.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamPF05018. DUF667. 1 hit.
PF11715. Nup160. 1 hit.
PF00400. WD40. 5 hits.
[Graphical view]
SMARTSM00320. WD40. 20 hits.
[Graphical view]
SUPFAMSSF50978. SSF50978. 3 hits.
SSF50998. SSF50998. 5 hits.
PROSITEPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSWDR90. human.
GenomeRNAi197335.
NextBio89648.
PROQ96KV7.

Entry information

Entry nameWDR90_HUMAN
AccessionPrimary (citable) accession number: Q96KV7
Secondary accession number(s): Q0VA87 expand/collapse secondary AC list , Q0VA88, Q6P048, Q6ZMS1, Q6ZTH1, Q8N202, Q8N221, Q8NBB8, Q96PW4, Q96S18
Entry history
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: June 10, 2008
Last modified: April 16, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM