SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96KR4

- LMLN_HUMAN

UniProt

Q96KR4 - LMLN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Leishmanolysin-like peptidase

Gene
LMLN
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Metalloprotease essential for the coordination of mitotic progression, and also plays a role in cell migration By similarity.

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi272 – 2721Zinc; catalytic By similarity
Active sitei273 – 2731 By similarity
Metal bindingi276 – 2761Zinc; catalytic By similarity
Metal bindingi378 – 3781Zinc; catalytic By similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. metalloendopeptidase activity Source: InterPro

GO - Biological processi

  1. cell adhesion Source: InterPro
  2. mitotic nuclear division Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM08.003.

Names & Taxonomyi

Protein namesi
Recommended name:
Leishmanolysin-like peptidase (EC:3.4.24.-)
Alternative name(s):
Invadolysin
Gene namesi
Name:LMLN
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:15991. LMLN.

Subcellular locationi

Cytoplasm. Lipid droplet
Note: Found in ring-like structures resembling invadopodia. In migrating cells it relocalizes from internal structures to the leading edge of cells.2 Publications

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. focal adhesion Source: HPA
  3. lipid particle Source: UniProtKB-SubCell
  4. membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Lipid droplet

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30402.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 655655Leishmanolysin-like peptidasePRO_0000303076Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi172 ↔ 235 By similarity
Glycosylationi308 – 3081N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi358 ↔ 419 By similarity
Disulfide bondi431 ↔ 525 By similarity
Disulfide bondi555 ↔ 602 By similarity
Glycosylationi615 – 6151N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ96KR4.
PRIDEiQ96KR4.

PTM databases

PhosphoSiteiQ96KR4.

Expressioni

Tissue specificityi

Expressed in all cell lines analyzed.1 Publication

Gene expression databases

ArrayExpressiQ96KR4.
BgeeiQ96KR4.
CleanExiHS_LMLN.
GenevestigatoriQ96KR4.

Organism-specific databases

HPAiHPA016481.
HPA028844.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000410926.

Structurei

3D structure databases

ProteinModelPortaliQ96KR4.
SMRiQ96KR4. Positions 242-282.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M8 family.

Phylogenomic databases

eggNOGiNOG279222.
HOGENOMiHOG000007103.
HOVERGENiHBG087499.
InParanoidiQ96KR4.
KOiK13539.
OMAiIRLNRKC.
OrthoDBiEOG780RNG.
PhylomeDBiQ96KR4.
TreeFamiTF315265.

Family and domain databases

InterProiIPR001577. Peptidase_M8.
[Graphical view]
PANTHERiPTHR10942. PTHR10942. 1 hit.
PfamiPF01457. Peptidase_M8. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96KR4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVTTLGPKMA AEWGGGVGYS GSGPGRSRWR WSGSVWVRSV LLLLGGLRAS    50
ATSTPVSLGS SPPCRHHVPS DTEVINKVHL KANHVVKRDV DEHLRIKTVY 100
DKSVEELLPE KKNLVKNKLF PQAISYLEKT FQVRRPAGTI LLSRQCATNQ 150
YLRKENDPHR YCTGECAAHT KCGPVIVPEE HLQQCRVYRG GKWPHGAVGV 200
PDQEGISDAD FVLYVGALAT ERCSHENIIS YAAYCQQEAN MDRPIAGYAN 250
LCPNMISTQP QEFVGMLSTV KHEVIHALGF SAGLFAFYHD KDGNPLTSRF 300
ADGLPPFNYS LGLYQWSDKV VRKVERLWDV RDNKIVRHTV YLLVTPRVVE 350
EARKHFDCPV LEGMELENQG GVGTELNHWE KRLLENEAMT GSHTQNRVLS 400
RITLALMEDT GRQMLSPYCD TLRSNPLQLT CRQDQRAVAV CNLQKFPKPL 450
PQEYQYFDEL SGIPAEDLPY YGGSVEIADY CPFSQEFSWH LSGEYQRSSD 500
CRILENQPEI FKNYGAEKYG PHSVCLIQKS AFVMEKCERK LSYPDWGSGC 550
YQVSCSPQGL KVWVQDTSYL CSRAGQVLPV SIQMNGWIHD GNLLCPSCWD 600
FCELCPPETD PPATNLTRAL PLDLCSCSSS LVVTLWLLLG NLFPLLAGFL 650
LCIWH 655
Length:655
Mass (Da):73,568
Last modified:May 18, 2010 - v2
Checksum:iD6A767CE3FA7A915
GO
Isoform 2 (identifier: Q96KR4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-73: MVTTLGPKMA...CRHHVPSDTE → MGRRSGLLGLRPGPEPVALER
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:640
Mass (Da):72,780
Checksum:i272AB99BBE391B42
GO
Isoform 3 (identifier: Q96KR4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

Show »
Length:692
Mass (Da):78,111
Checksum:i3000E53236452C1D
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti106 – 1061E → D.
Corresponds to variant rs7373165 [ dbSNP | Ensembl ].
VAR_060158

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7373MVTTL…PSDTE → MGRRSGLLGLRPGPEPVALE R in isoform 2. VSP_028002Add
BLAST
Alternative sequencei411 – 4111G → GWYKANYSMAEKLDWGRGMG CDFVRKSCKFWIDQQRQK in isoform 2 and isoform 3. VSP_028003

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti539 – 5391R → K in CAP49203. 1 Publication
Sequence conflicti539 – 5391R → K in CAP49204. 1 Publication
Sequence conflicti539 – 5391R → K in CAC42882. 1 Publication
Sequence conflicti539 – 5391R → K in CAC42883. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AM920777 mRNA. Translation: CAP49203.1.
AM920778 mRNA. Translation: CAP49204.1.
AJ312398 mRNA. Translation: CAC42882.1.
AJ312399 mRNA. Translation: CAC42883.1.
AC135893 Genomic DNA. No translation available.
CCDSiCCDS3332.1. [Q96KR4-1]
CCDS46988.1. [Q96KR4-3]
RefSeqiNP_001129521.2. NM_001136049.2. [Q96KR4-3]
NP_149018.2. NM_033029.3. [Q96KR4-1]
UniGeneiHs.518540.

Genome annotation databases

EnsembliENST00000330198; ENSP00000328829; ENSG00000185621. [Q96KR4-1]
ENST00000420910; ENSP00000410926; ENSG00000185621. [Q96KR4-3]
ENST00000482695; ENSP00000418324; ENSG00000185621. [Q96KR4-2]
GeneIDi89782.
KEGGihsa:89782.
UCSCiuc003fyt.3. human. [Q96KR4-2]
uc011buo.2. human. [Q96KR4-1]

Polymorphism databases

DMDMi296434578.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AM920777 mRNA. Translation: CAP49203.1 .
AM920778 mRNA. Translation: CAP49204.1 .
AJ312398 mRNA. Translation: CAC42882.1 .
AJ312399 mRNA. Translation: CAC42883.1 .
AC135893 Genomic DNA. No translation available.
CCDSi CCDS3332.1. [Q96KR4-1 ]
CCDS46988.1. [Q96KR4-3 ]
RefSeqi NP_001129521.2. NM_001136049.2. [Q96KR4-3 ]
NP_149018.2. NM_033029.3. [Q96KR4-1 ]
UniGenei Hs.518540.

3D structure databases

ProteinModelPortali Q96KR4.
SMRi Q96KR4. Positions 242-282.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000410926.

Protein family/group databases

MEROPSi M08.003.

PTM databases

PhosphoSitei Q96KR4.

Polymorphism databases

DMDMi 296434578.

Proteomic databases

PaxDbi Q96KR4.
PRIDEi Q96KR4.

Protocols and materials databases

DNASUi 89782.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000330198 ; ENSP00000328829 ; ENSG00000185621 . [Q96KR4-1 ]
ENST00000420910 ; ENSP00000410926 ; ENSG00000185621 . [Q96KR4-3 ]
ENST00000482695 ; ENSP00000418324 ; ENSG00000185621 . [Q96KR4-2 ]
GeneIDi 89782.
KEGGi hsa:89782.
UCSCi uc003fyt.3. human. [Q96KR4-2 ]
uc011buo.2. human. [Q96KR4-1 ]

Organism-specific databases

CTDi 89782.
GeneCardsi GC03P197687.
HGNCi HGNC:15991. LMLN.
HPAi HPA016481.
HPA028844.
MIMi 609380. gene.
neXtProti NX_Q96KR4.
PharmGKBi PA30402.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG279222.
HOGENOMi HOG000007103.
HOVERGENi HBG087499.
InParanoidi Q96KR4.
KOi K13539.
OMAi IRLNRKC.
OrthoDBi EOG780RNG.
PhylomeDBi Q96KR4.
TreeFami TF315265.

Miscellaneous databases

GenomeRNAii 89782.
NextBioi 35470729.
PROi Q96KR4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96KR4.
Bgeei Q96KR4.
CleanExi HS_LMLN.
Genevestigatori Q96KR4.

Family and domain databases

InterProi IPR001577. Peptidase_M8.
[Graphical view ]
PANTHERi PTHR10942. PTHR10942. 1 hit.
Pfami PF01457. Peptidase_M8. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The conserved metalloprotease invadolysin localizes to the surface of lipid droplets."
    Cobbe N., Marshall K.M., Gururaja Rao S., Chang C.W., Di Cara F., Duca E., Vass S., Kassan A., Heck M.M.
    J. Cell Sci. 122:3414-3423(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Testis.
  2. "Cloning and expression of splice variants of leishmanolysin-like protein, a human form of the protozoan leishmanolysin, EC 3.4.24.36."
    Chen J.M., Fortunato M., Barrett A.J.
    Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
    Tissue: Colon and Testis.
  3. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Invadolysin: a novel, conserved metalloprotease links mitotic structural rearrangements with cell migration."
    McHugh B., Krause S.A., Yu B., Deans A.M., Heasman S., McLaughlin P., Heck M.M.
    J. Cell Biol. 167:673-686(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiLMLN_HUMAN
AccessioniPrimary (citable) accession number: Q96KR4
Secondary accession number(s): B3LDG9
, B3LDH0, C9J796, F8WB28, Q96KR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: May 18, 2010
Last modified: September 3, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi