Q96KR4 (LMLN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Leishmanolysin-like peptidase EC=3.4.24.- Alternative name(s): Invadolysin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 655 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Metalloprotease essential for the coordination of mitotic progression, and also plays a role in cell migration By similarity. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subcellular location | Cytoplasm. Lipid droplet. Note: Found in ring-like structures resembling invadopodia. In migrating cells it relocalizes from internal structures to the leading edge of cells. Ref.1 Ref.4 |
| Tissue specificity | Expressed in all cell lines analyzed. Ref.1 |
| Sequence similarities | Belongs to the peptidase M8 family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96KR4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96KR4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-73: MVTTLGPKMA...CRHHVPSDTE → MGRRSGLLGLRPGPEPVALER 411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK | ||||||
| Isoform 3 (identifier: Q96KR4-3) The sequence of this isoform differs from the canonical sequence as follows: 411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 655 | 655 | Leishmanolysin-like peptidase | PRO_0000303076 | |||||||
Sites | |||||||||||
| Active site | 273 | 1 | By similarity | ||||||||
| Metal binding | 272 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 276 | 1 | Zinc; catalytic By similarity | ||||||||
| Metal binding | 378 | 1 | Zinc; catalytic By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 308 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 615 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 172 ↔ 235 | By similarity | |||||||||
| Disulfide bond | 358 ↔ 419 | By similarity | |||||||||
| Disulfide bond | 431 ↔ 525 | By similarity | |||||||||
| Disulfide bond | 555 ↔ 602 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 73 | 73 | MVTTL…PSDTE → MGRRSGLLGLRPGPEPVALE R in isoform 2. | VSP_028002 | |||||||
| Alternative sequence | 411 | 1 | G → GWYKANYSMAEKLDWGRGMG CDFVRKSCKFWIDQQRQK in isoform 2 and isoform 3. | VSP_028003 | |||||||
| Natural variant | 106 | 1 | E → D. Corresponds to variant rs7373165 [ dbSNP | Ensembl ]. | VAR_060158 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 539 | 1 | R → K in CAP49203. Ref.1 | ||||||||
| Sequence conflict | 539 | 1 | R → K in CAP49204. Ref.1 | ||||||||
| Sequence conflict | 539 | 1 | R → K in CAC42882. Ref.2 | ||||||||
| Sequence conflict | 539 | 1 | R → K in CAC42883. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The conserved metalloprotease invadolysin localizes to the surface of lipid droplets." Cobbe N., Marshall K.M., Gururaja Rao S., Chang C.W., Di Cara F., Duca E., Vass S., Kassan A., Heck M.M. J. Cell Sci. 122:3414-3423(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Testis. |
| [2] | "Cloning and expression of splice variants of leishmanolysin-like protein, a human form of the protozoan leishmanolysin, EC 3.4.24.36." Chen J.M., Fortunato M., Barrett A.J. Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). Tissue: Colon and Testis. |
| [3] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Invadolysin: a novel, conserved metalloprotease links mitotic structural rearrangements with cell migration." McHugh B., Krause S.A., Yu B., Deans A.M., Heasman S., McLaughlin P., Heck M.M. J. Cell Biol. 167:673-686(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AM920777 mRNA. Translation: CAP49203.1. AM920778 mRNA. Translation: CAP49204.1. AJ312398 mRNA. Translation: CAC42882.1. AJ312399 mRNA. Translation: CAC42883.1. AC135893 Genomic DNA. No translation available. |
| IPI | IPI00064741. IPI00903090. IPI00924964. |
| RefSeq | NP_001129521.2. NM_001136049.2. NP_149018.2. NM_033029.3. |
| UniGene | Hs.518540. |
3D structure databases | |
| ProteinModelPortal | Q96KR4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000410926. |
Protein family/group databases | |
| MEROPS | M08.003. |
PTM databases | |
| PhosphoSite | Q96KR4. |
Polymorphism databases | |
| DMDM | 296434578. |
Proteomic databases | |
| PaxDb | Q96KR4. |
| PRIDE | Q96KR4. |
Protocols and materials databases | |
| DNASU | 89782. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000330198; ENSP00000328829; ENSG00000185621. ENST00000420910; ENSP00000410926; ENSG00000185621. ENST00000482695; ENSP00000418324; ENSG00000185621. |
| GeneID | 89782. |
| KEGG | hsa:89782. |
| UCSC | uc003fyt.3. human. uc011buo.2. human. |
Organism-specific databases | |
| CTD | 89782. |
| GeneCards | GC03P197687. |
| HGNC | HGNC:15991. LMLN. |
| HPA | HPA016481. HPA028844. |
| MIM | 609380. gene. |
| neXtProt | NX_Q96KR4. |
| PharmGKB | PA30402. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG279222. |
| HOGENOM | HOG000007103. |
| HOVERGEN | HBG087499. |
| InParanoid | Q96KR4. |
| KO | K13539. |
| OrthoDB | EOG4S7JPH. |
Gene expression databases | |
| ArrayExpress | Q96KR4. |
| Bgee | Q96KR4. |
| CleanEx | HS_LMLN. |
| Genevestigator | Q96KR4. |
Family and domain databases | |
| InterPro | IPR001577. Peptidase_M8. [Graphical view] |
| PANTHER | PTHR10942. PTHR10942. 1 hit. |
| Pfam | PF01457. Peptidase_M8. 1 hit. [Graphical view] |
| PROSITE | PS00142. ZINC_PROTEASE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 89782. |
| NextBio | 35470729. |
| SOURCE | Search... |
Entry information
| Entry name | LMLN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96KR4 Secondary accession number(s): B3LDG9 Q96KR5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
