Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96KR4

- LMLN_HUMAN

UniProt

Q96KR4 - LMLN_HUMAN

Protein

Leishmanolysin-like peptidase

Gene

LMLN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metalloprotease essential for the coordination of mitotic progression, and also plays a role in cell migration.By similarity

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi272 – 2721Zinc; catalyticBy similarity
    Active sitei273 – 2731By similarity
    Metal bindingi276 – 2761Zinc; catalyticBy similarity
    Metal bindingi378 – 3781Zinc; catalyticBy similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. metalloendopeptidase activity Source: InterPro

    GO - Biological processi

    1. cell adhesion Source: InterPro
    2. mitotic nuclear division Source: UniProtKB-KW

    Keywords - Molecular functioni

    Hydrolase, Metalloprotease, Protease

    Keywords - Biological processi

    Cell cycle, Cell division, Mitosis

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM08.003.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leishmanolysin-like peptidase (EC:3.4.24.-)
    Alternative name(s):
    Invadolysin
    Gene namesi
    Name:LMLN
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:15991. LMLN.

    Subcellular locationi

    Cytoplasm. Lipid droplet
    Note: Found in ring-like structures resembling invadopodia. In migrating cells it relocalizes from internal structures to the leading edge of cells.

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. focal adhesion Source: HPA
    3. lipid particle Source: UniProtKB-SubCell
    4. membrane Source: InterPro

    Keywords - Cellular componenti

    Cytoplasm, Lipid droplet

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30402.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 655655Leishmanolysin-like peptidasePRO_0000303076Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi172 ↔ 235By similarity
    Glycosylationi308 – 3081N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi358 ↔ 419By similarity
    Disulfide bondi431 ↔ 525By similarity
    Disulfide bondi555 ↔ 602By similarity
    Glycosylationi615 – 6151N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ96KR4.
    PRIDEiQ96KR4.

    PTM databases

    PhosphoSiteiQ96KR4.

    Expressioni

    Tissue specificityi

    Expressed in all cell lines analyzed.1 Publication

    Gene expression databases

    ArrayExpressiQ96KR4.
    BgeeiQ96KR4.
    CleanExiHS_LMLN.
    GenevestigatoriQ96KR4.

    Organism-specific databases

    HPAiHPA016481.
    HPA028844.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000410926.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96KR4.
    SMRiQ96KR4. Positions 242-282.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase M8 family.Curated

    Phylogenomic databases

    eggNOGiNOG279222.
    HOGENOMiHOG000007103.
    HOVERGENiHBG087499.
    InParanoidiQ96KR4.
    KOiK13539.
    OMAiIRLNRKC.
    OrthoDBiEOG780RNG.
    PhylomeDBiQ96KR4.
    TreeFamiTF315265.

    Family and domain databases

    InterProiIPR001577. Peptidase_M8.
    [Graphical view]
    PANTHERiPTHR10942. PTHR10942. 1 hit.
    PfamiPF01457. Peptidase_M8. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96KR4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVTTLGPKMA AEWGGGVGYS GSGPGRSRWR WSGSVWVRSV LLLLGGLRAS    50
    ATSTPVSLGS SPPCRHHVPS DTEVINKVHL KANHVVKRDV DEHLRIKTVY 100
    DKSVEELLPE KKNLVKNKLF PQAISYLEKT FQVRRPAGTI LLSRQCATNQ 150
    YLRKENDPHR YCTGECAAHT KCGPVIVPEE HLQQCRVYRG GKWPHGAVGV 200
    PDQEGISDAD FVLYVGALAT ERCSHENIIS YAAYCQQEAN MDRPIAGYAN 250
    LCPNMISTQP QEFVGMLSTV KHEVIHALGF SAGLFAFYHD KDGNPLTSRF 300
    ADGLPPFNYS LGLYQWSDKV VRKVERLWDV RDNKIVRHTV YLLVTPRVVE 350
    EARKHFDCPV LEGMELENQG GVGTELNHWE KRLLENEAMT GSHTQNRVLS 400
    RITLALMEDT GRQMLSPYCD TLRSNPLQLT CRQDQRAVAV CNLQKFPKPL 450
    PQEYQYFDEL SGIPAEDLPY YGGSVEIADY CPFSQEFSWH LSGEYQRSSD 500
    CRILENQPEI FKNYGAEKYG PHSVCLIQKS AFVMEKCERK LSYPDWGSGC 550
    YQVSCSPQGL KVWVQDTSYL CSRAGQVLPV SIQMNGWIHD GNLLCPSCWD 600
    FCELCPPETD PPATNLTRAL PLDLCSCSSS LVVTLWLLLG NLFPLLAGFL 650
    LCIWH 655
    Length:655
    Mass (Da):73,568
    Last modified:May 18, 2010 - v2
    Checksum:iD6A767CE3FA7A915
    GO
    Isoform 2 (identifier: Q96KR4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-73: MVTTLGPKMA...CRHHVPSDTE → MGRRSGLLGLRPGPEPVALER
         411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

    Show »
    Length:640
    Mass (Da):72,780
    Checksum:i272AB99BBE391B42
    GO
    Isoform 3 (identifier: Q96KR4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         411-411: G → GWYKANYSMAEKLDWGRGMGCDFVRKSCKFWIDQQRQK

    Show »
    Length:692
    Mass (Da):78,111
    Checksum:i3000E53236452C1D
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti539 – 5391R → K in CAP49203. (PubMed:19706689)Curated
    Sequence conflicti539 – 5391R → K in CAP49204. (PubMed:19706689)Curated
    Sequence conflicti539 – 5391R → K in CAC42882. 1 PublicationCurated
    Sequence conflicti539 – 5391R → K in CAC42883. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti106 – 1061E → D.
    Corresponds to variant rs7373165 [ dbSNP | Ensembl ].
    VAR_060158

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7373MVTTL…PSDTE → MGRRSGLLGLRPGPEPVALE R in isoform 2. 2 PublicationsVSP_028002Add
    BLAST
    Alternative sequencei411 – 4111G → GWYKANYSMAEKLDWGRGMG CDFVRKSCKFWIDQQRQK in isoform 2 and isoform 3. 2 PublicationsVSP_028003

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AM920777 mRNA. Translation: CAP49203.1.
    AM920778 mRNA. Translation: CAP49204.1.
    AJ312398 mRNA. Translation: CAC42882.1.
    AJ312399 mRNA. Translation: CAC42883.1.
    AC135893 Genomic DNA. No translation available.
    CCDSiCCDS3332.1. [Q96KR4-1]
    CCDS46988.1. [Q96KR4-3]
    RefSeqiNP_001129521.2. NM_001136049.2. [Q96KR4-3]
    NP_149018.2. NM_033029.3. [Q96KR4-1]
    UniGeneiHs.518540.

    Genome annotation databases

    EnsembliENST00000330198; ENSP00000328829; ENSG00000185621. [Q96KR4-1]
    ENST00000420910; ENSP00000410926; ENSG00000185621. [Q96KR4-3]
    ENST00000482695; ENSP00000418324; ENSG00000185621. [Q96KR4-2]
    GeneIDi89782.
    KEGGihsa:89782.
    UCSCiuc003fyt.3. human. [Q96KR4-2]
    uc011buo.2. human. [Q96KR4-1]

    Polymorphism databases

    DMDMi296434578.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AM920777 mRNA. Translation: CAP49203.1 .
    AM920778 mRNA. Translation: CAP49204.1 .
    AJ312398 mRNA. Translation: CAC42882.1 .
    AJ312399 mRNA. Translation: CAC42883.1 .
    AC135893 Genomic DNA. No translation available.
    CCDSi CCDS3332.1. [Q96KR4-1 ]
    CCDS46988.1. [Q96KR4-3 ]
    RefSeqi NP_001129521.2. NM_001136049.2. [Q96KR4-3 ]
    NP_149018.2. NM_033029.3. [Q96KR4-1 ]
    UniGenei Hs.518540.

    3D structure databases

    ProteinModelPortali Q96KR4.
    SMRi Q96KR4. Positions 242-282.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000410926.

    Protein family/group databases

    MEROPSi M08.003.

    PTM databases

    PhosphoSitei Q96KR4.

    Polymorphism databases

    DMDMi 296434578.

    Proteomic databases

    PaxDbi Q96KR4.
    PRIDEi Q96KR4.

    Protocols and materials databases

    DNASUi 89782.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000330198 ; ENSP00000328829 ; ENSG00000185621 . [Q96KR4-1 ]
    ENST00000420910 ; ENSP00000410926 ; ENSG00000185621 . [Q96KR4-3 ]
    ENST00000482695 ; ENSP00000418324 ; ENSG00000185621 . [Q96KR4-2 ]
    GeneIDi 89782.
    KEGGi hsa:89782.
    UCSCi uc003fyt.3. human. [Q96KR4-2 ]
    uc011buo.2. human. [Q96KR4-1 ]

    Organism-specific databases

    CTDi 89782.
    GeneCardsi GC03P197687.
    HGNCi HGNC:15991. LMLN.
    HPAi HPA016481.
    HPA028844.
    MIMi 609380. gene.
    neXtProti NX_Q96KR4.
    PharmGKBi PA30402.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG279222.
    HOGENOMi HOG000007103.
    HOVERGENi HBG087499.
    InParanoidi Q96KR4.
    KOi K13539.
    OMAi IRLNRKC.
    OrthoDBi EOG780RNG.
    PhylomeDBi Q96KR4.
    TreeFami TF315265.

    Miscellaneous databases

    GenomeRNAii 89782.
    NextBioi 35470729.
    PROi Q96KR4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96KR4.
    Bgeei Q96KR4.
    CleanExi HS_LMLN.
    Genevestigatori Q96KR4.

    Family and domain databases

    InterProi IPR001577. Peptidase_M8.
    [Graphical view ]
    PANTHERi PTHR10942. PTHR10942. 1 hit.
    Pfami PF01457. Peptidase_M8. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The conserved metalloprotease invadolysin localizes to the surface of lipid droplets."
      Cobbe N., Marshall K.M., Gururaja Rao S., Chang C.W., Di Cara F., Duca E., Vass S., Kassan A., Heck M.M.
      J. Cell Sci. 122:3414-3423(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), SUBCELLULAR LOCATION, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
      Tissue: Testis.
    2. "Cloning and expression of splice variants of leishmanolysin-like protein, a human form of the protozoan leishmanolysin, EC 3.4.24.36."
      Chen J.M., Fortunato M., Barrett A.J.
      Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
      Tissue: Colon and Testis.
    3. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Invadolysin: a novel, conserved metalloprotease links mitotic structural rearrangements with cell migration."
      McHugh B., Krause S.A., Yu B., Deans A.M., Heasman S., McLaughlin P., Heck M.M.
      J. Cell Biol. 167:673-686(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiLMLN_HUMAN
    AccessioniPrimary (citable) accession number: Q96KR4
    Secondary accession number(s): B3LDG9
    , B3LDH0, C9J796, F8WB28, Q96KR5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 95 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. Peptidase families
      Classification of peptidase families and list of entries
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3