Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TNFAIP3-interacting protein 3

Gene

TNIP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Binds to zinc finger protein TNFAIP3 and inhibits NF-kappa-B activation induced by tumor necrosis factor, Toll-like receptor 4 (TLR4), interleukin-1 and 12-O-tetradecanoylphorbol-13-acetate. Overexpression inhibits NF-kappa-B-dependent gene expression in response to lipopolysaccharide at a level downstream of TRAF6 and upstream of IKBKB. NF-kappa-B inhibition is independent of TNFAIP3 binding.1 Publication

GO - Molecular functioni

  • polyubiquitin binding Source: UniProtKB

GO - Biological processi

  • cellular response to lipopolysaccharide Source: UniProtKB
  • inflammatory response Source: UniProtKB-KW
  • MyD88-independent toll-like receptor signaling pathway Source: UniProtKB
  • negative regulation of I-kappaB kinase/NF-kappaB signaling Source: UniProtKB
  • toll-like receptor 4 signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Inflammatory response

Names & Taxonomyi

Protein namesi
Recommended name:
TNFAIP3-interacting protein 3
Alternative name(s):
A20-binding inhibitor of NF-kappa-B activation 3
Short name:
ABIN-3
Listeria-induced gene protein
Gene namesi
Name:TNIP3Imported
Synonyms:ABIN3, LIND
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:19315. TNIP3.

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi214 – 2152ER → AA: Abolishes ubiquitin binding; loss of inhibitory activity on NF-kappa-B activation. 1 Publication

Organism-specific databases

PharmGKBiPA134934429.

Polymorphism and mutation databases

BioMutaiTNIP3.
DMDMi269849474.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 325325TNFAIP3-interacting protein 3PRO_0000072607Add
BLAST

Proteomic databases

EPDiQ96KP6.
PaxDbiQ96KP6.
PRIDEiQ96KP6.

PTM databases

iPTMnetiQ96KP6.
PhosphoSiteiQ96KP6.

Expressioni

Tissue specificityi

Highly expressed in lung, lymph node, thymus and fetal liver. Expressed at lower levels in bone marrow, brain, kidney, spleen, leukocytes and tonsils. Could be detected in heart, salivary gland, adrenal gland, pancreas, ovary and fetal brain. High levels detected in liver, colon, small intestine, muscle, stomach, testis, placenta, thyroid, uterus, prostate, skin and PBL.2 Publications

Inductioni

By Listeria infection. Expression is slightly down-regulated by dexamethasone and slightly up-regulated by IL-10. Strongly induced mRNA and protein expression by lipopolysaccharide.2 Publications

Gene expression databases

BgeeiQ96KP6.
CleanExiHS_TNIP3.
ExpressionAtlasiQ96KP6. baseline and differential.
GenevisibleiQ96KP6. HS.

Organism-specific databases

HPAiHPA043063.

Interactioni

Subunit structurei

Interacts with TNFAIP3. Interacts with polyubiquitin.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
DAZAP2Q150383EBI-2509913,EBI-724310
KRT40Q6A1624EBI-2509913,EBI-10171697
KRTAP10-8P604103EBI-2509913,EBI-10171774
LZTS2Q9BRK43EBI-2509913,EBI-741037
NOTCH2NLQ7Z3S93EBI-2509913,EBI-945833
TAX1BP1Q86VP13EBI-2509913,EBI-529518
TNFAIP3P215803EBI-2509913,EBI-527670
TNIP1Q150253EBI-2509913,EBI-357849
ZBTB8AQ96BR93EBI-2509913,EBI-742740

GO - Molecular functioni

  • polyubiquitin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi123006. 12 interactions.
IntActiQ96KP6. 23 interactions.
STRINGi9606.ENSP00000057513.

Structurei

3D structure databases

ProteinModelPortaliQ96KP6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni190 – 24859Ubiquitin-binding domain (UBD)Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili27 – 265239Sequence analysisAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGHG. Eukaryota.
ENOG410YIE3. LUCA.
GeneTreeiENSGT00510000046908.
HOGENOMiHOG000013050.
HOVERGENiHBG069354.
InParanoidiQ96KP6.
OMAiLEQKIRC.
OrthoDBiEOG7SJD44.
PhylomeDBiQ96KP6.
TreeFamiTF351138.

Family and domain databases

InterProiIPR032419. CC2-LZ_dom.
[Graphical view]
PfamiPF16516. CC2-LZ. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96KP6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAHFVQGTSR MIAAESSTEH KECAEPSTRK NLMNSLEQKI RCLEKQRKEL
60 70 80 90 100
LEVNQQWDQQ FRSMKELYER KVAELKTKLD AAERFLSTRE KDPHQRQRKD
110 120 130 140 150
DRQREDDRQR DLTRDRLQRE EKEKERLNEE LHELKEENKL LKGKNTLANK
160 170 180 190 200
EKEHYECEIK RLNKALQDAL NIKCSFSEDC LRKSRVEFCH EEMRTEMEVL
210 220 230 240 250
KQQVQIYEED FKKERSDRER LNQEKEELQQ INETSQSQLN RLNSQIKACQ
260 270 280 290 300
MEKEKLEKQL KQMYCPPCNC GLVFHLQDPW VPTGPGAVQK QREHPPDYQW
310 320
YALDQLPPDV QHKANGLSSV KKVHP
Length:325
Mass (Da):38,943
Last modified:November 24, 2009 - v2
Checksum:iC03EDCCA38B59D29
GO
Isoform 2 (identifier: Q96KP6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNKNEKHDDKLVMFTNQSEDSERCESMELDKKIQDLIERNASPHPKRFTPEAMPTHRNLCSLKTPGKTASM
     296-325: PDYQWYALDQLPPDVQHKANGLSSVKKVHP → VYPQ

Show »
Length:369
Mass (Da):44,085
Checksum:iC6A8CE357D9379B5
GO
Isoform 3 (identifier: Q96KP6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MIPCGWLMNK...LKTPGKTASM
     296-325: PDYQWYALDQLPPDVQHKANGLSSVKKVHP → VYPQ

Show »
Length:376
Mass (Da):44,886
Checksum:i71F05AE911BAC6EA
GO

Sequence cautioni

The sequence BAB15018.1 differs from that shown. Reason: Frameshift at position 272. Curated
The sequence BAB15018.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAC85929.1 differs from that shown. Reason: Frameshift at position 272. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti109 – 1091Q → H in AAI28409 (PubMed:15489334).Curated
Sequence conflicti298 – 2981Y → C in AAL02151 (PubMed:11345586).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti99 – 991K → E.
Corresponds to variant rs10000692 [ dbSNP | Ensembl ].
VAR_057006

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MNKNEKHDDKLVMFTNQSED SERCESMELDKKIQDLIERN ASPHPKRFTPEAMPTHRNLC SLKTPGKTASM in isoform 2. 1 PublicationVSP_045101
Alternative sequencei1 – 11M → MIPCGWLMNKNEKHDDKLVM FTNQSEDSERCESMELDKKI QDLIERNASPHPKRFTPEAM PTHRNLCSLKTPGKTASM in isoform 3. 1 PublicationVSP_045102
Alternative sequencei296 – 32530PDYQW…KKVHP → VYPQ in isoform 2 and isoform 3. 1 PublicationVSP_045103Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277289 mRNA. Translation: AAL02151.1.
AJ320534 mRNA. Translation: CAC85929.1. Frameshift.
AK024815 mRNA. Translation: BAB15018.1. Sequence problems.
AK290409 mRNA. Translation: BAF83098.1.
AK301058 mRNA. Translation: BAG62667.1.
AK303192 mRNA. Translation: BAG64285.1.
AC105254 Genomic DNA. No translation available.
AC108027 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX05264.1.
BC128408 mRNA. Translation: AAI28409.1.
CCDSiCCDS3718.1. [Q96KP6-1]
CCDS58925.1. [Q96KP6-2]
CCDS58926.1. [Q96KP6-3]
RefSeqiNP_001122315.2. NM_001128843.2. [Q96KP6-2]
NP_001231693.1. NM_001244764.1. [Q96KP6-3]
NP_079149.3. NM_024873.5. [Q96KP6-1]
UniGeneiHs.208206.

Genome annotation databases

EnsembliENST00000057513; ENSP00000057513; ENSG00000050730. [Q96KP6-1]
ENST00000507879; ENSP00000427106; ENSG00000050730. [Q96KP6-2]
ENST00000509841; ENSP00000426613; ENSG00000050730. [Q96KP6-3]
GeneIDi79931.
KEGGihsa:79931.
UCSCiuc010ing.4. human. [Q96KP6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF277289 mRNA. Translation: AAL02151.1.
AJ320534 mRNA. Translation: CAC85929.1. Frameshift.
AK024815 mRNA. Translation: BAB15018.1. Sequence problems.
AK290409 mRNA. Translation: BAF83098.1.
AK301058 mRNA. Translation: BAG62667.1.
AK303192 mRNA. Translation: BAG64285.1.
AC105254 Genomic DNA. No translation available.
AC108027 Genomic DNA. No translation available.
CH471056 Genomic DNA. Translation: EAX05264.1.
BC128408 mRNA. Translation: AAI28409.1.
CCDSiCCDS3718.1. [Q96KP6-1]
CCDS58925.1. [Q96KP6-2]
CCDS58926.1. [Q96KP6-3]
RefSeqiNP_001122315.2. NM_001128843.2. [Q96KP6-2]
NP_001231693.1. NM_001244764.1. [Q96KP6-3]
NP_079149.3. NM_024873.5. [Q96KP6-1]
UniGeneiHs.208206.

3D structure databases

ProteinModelPortaliQ96KP6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123006. 12 interactions.
IntActiQ96KP6. 23 interactions.
STRINGi9606.ENSP00000057513.

PTM databases

iPTMnetiQ96KP6.
PhosphoSiteiQ96KP6.

Polymorphism and mutation databases

BioMutaiTNIP3.
DMDMi269849474.

Proteomic databases

EPDiQ96KP6.
PaxDbiQ96KP6.
PRIDEiQ96KP6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000057513; ENSP00000057513; ENSG00000050730. [Q96KP6-1]
ENST00000507879; ENSP00000427106; ENSG00000050730. [Q96KP6-2]
ENST00000509841; ENSP00000426613; ENSG00000050730. [Q96KP6-3]
GeneIDi79931.
KEGGihsa:79931.
UCSCiuc010ing.4. human. [Q96KP6-1]

Organism-specific databases

CTDi79931.
GeneCardsiTNIP3.
H-InvDBHIX0004478.
HGNCiHGNC:19315. TNIP3.
HPAiHPA043063.
MIMi608019. gene.
neXtProtiNX_Q96KP6.
PharmGKBiPA134934429.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGHG. Eukaryota.
ENOG410YIE3. LUCA.
GeneTreeiENSGT00510000046908.
HOGENOMiHOG000013050.
HOVERGENiHBG069354.
InParanoidiQ96KP6.
OMAiLEQKIRC.
OrthoDBiEOG7SJD44.
PhylomeDBiQ96KP6.
TreeFamiTF351138.

Miscellaneous databases

GenomeRNAii79931.
PROiQ96KP6.
SOURCEiSearch...

Gene expression databases

BgeeiQ96KP6.
CleanExiHS_TNIP3.
ExpressionAtlasiQ96KP6. baseline and differential.
GenevisibleiQ96KP6. HS.

Family and domain databases

InterProiIPR032419. CC2-LZ_dom.
[Graphical view]
PfamiPF16516. CC2-LZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Two novel genes FIND and LIND differentially expressed in deactivated and Listeria-infected human macrophages."
    Staege H., Brauchlin A., Schoedon G., Schaffner A.
    Immunogenetics 53:105-113(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, INDUCTION.
    Tissue: Macrophage1 Publication and Monocyte.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH TNFAIP3, TISSUE SPECIFICITY, INDUCTION.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Smooth muscleImported, Spleen, Thymus and Umbilical cord blood.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  7. "Ubiquitin binding mediates the NF-kappaB inhibitory potential of ABIN proteins."
    Wagner S., Carpentier I., Rogov V., Kreike M., Ikeda F., Lohr F., Wu C.J., Ashwell J.D., Dotsch V., Dikic I., Beyaert R.
    Oncogene 27:3739-3745(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITIN-BINDING, MUTAGENESIS OF 214-GLU-ARG-215.

Entry informationi

Entry nameiTNIP3_HUMAN
AccessioniPrimary (citable) accession number: Q96KP6
Secondary accession number(s): A1A574
, A8K2Z4, B4DVF5, B4E023, Q96PQ3, Q9H780
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: November 24, 2009
Last modified: June 8, 2016
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.