Q96KN7 (RPGR1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 Short name=RPGR-interacting protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1286 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential for RPGR function and is also required for normal disk morphogenesis By similarity. |
| Subunit structure | Forms homodimers and elongated homopolymers By similarity. Interacts with RPGR. Interacts with NPHP4. Ref.1 Ref.2 Ref.8 |
| Subcellular location | Cell projection › cilium By similarity. Note: Situated between the axonemal microtubules and the plasma membrane By similarity. |
| Tissue specificity | Strong expression in retina, with weaker expression in testis. Expressed in other neurons such as amacrine cells. Colocalizes with RGPR in the outer segment of rod photoreceptors and cone outer segments. Ref.1 Ref.2 Ref.7 |
| Involvement in disease | Leber congenital amaurosis 6 (LCA6) [MIM:613826]: A severe dystrophy of the retina, typically becoming evident in the first years of life. Visual function is usually poor and often accompanied by nystagmus, sluggish or near-absent pupillary responses, photophobia, high hyperopia and keratoconus. Cone-rod dystrophy 13 (CORD13) [MIM:608194]: An inherited retinal dystrophy characterized by retinal pigment deposits visible on fundus examination, predominantly in the macular region, and initial loss of cone photoreceptors followed by rod degeneration. This leads to decreased visual acuity and sensitivity in the central visual field, followed by loss of peripheral vision. Severe loss of vision occurs earlier than in retinitis pigmentosa. Heterozygous non-synonymous variants of RPGRIP1 may cause or increase the susceptibility to various forms of glaucoma, a genetically heterogeneous disorder. It is the second cause of blindness worldwide owing to the progressive degeneration of retinal ganglion neurons. |
| Sequence similarities | Belongs to the RPGRIP1 family. Contains 1 C2 domain. |
| Sequence caution | The sequence CAE11866.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Sensory transduction Vision |
| Cellular component | Cell projection Cilium |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Ciliopathy Cone-rod dystrophy Disease mutation Glaucoma Leber congenital amaurosis |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | eye photoreceptor cell development Inferred from electronic annotation. Source: Compara response to stimulusInferred from electronic annotation. Source: UniProtKB-KW retina development in camera-type eyeInferred from electronic annotation. Source: Compara visual perceptionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | axoneme Inferred from electronic annotation. Source: Compara ciliumInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 6 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96KN7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96KN7-2) Also known as: a; The sequence of this isoform differs from the canonical sequence as follows: 1-617: Missing. 618-623: ISLLHQ → MTFQHL | ||||||
| Isoform 3 (identifier: Q96KN7-3) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 1-641: Missing. 642-673: LAQAGDTQPTTFCTYSFYDFETHCTPLSVGPQ → MLLMAPDRCRYVWKHCQPMEMRIKWIFLCCIR | ||||||
| Isoform 4 (identifier: Q96KN7-4) The sequence of this isoform differs from the canonical sequence as follows: 1-358: Missing. 359-383: EFQERVEDLEKERKLLNDNYDKLLE → MLKLDNKDVISHPLGYPSESLLSIA 588-903: Missing. | ||||||
| Isoform 5 (identifier: Q96KN7-5) The sequence of this isoform differs from the canonical sequence as follows: 1-384: Missing. | ||||||
| Isoform 6 (identifier: Q96KN7-6) The sequence of this isoform differs from the canonical sequence as follows: 1-384: Missing. 966-1286: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1286 | 1286 | X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 | PRO_0000097432 | |||||
Regions | |||||||||
| Domain | 801 – 890 | 90 | C2 | ||||||
| Region | 952 – 1281 | 330 | Interaction with RPGR | ||||||
| Coiled coil | 294 – 584 | 291 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 641 | 641 | Missing in isoform 3. | VSP_009522 | |||||
| Alternative sequence | 1 – 617 | 617 | Missing in isoform 2. | VSP_009521 | |||||
| Alternative sequence | 1 – 384 | 384 | Missing in isoform 5 and isoform 6. | VSP_009520 | |||||
| Alternative sequence | 1 – 358 | 358 | Missing in isoform 4. | VSP_009519 | |||||
| Alternative sequence | 359 – 383 | 25 | EFQER…DKLLE → MLKLDNKDVISHPLGYPSES LLSIA in isoform 4. | VSP_009523 | |||||
| Alternative sequence | 588 – 903 | 316 | Missing in isoform 4. | VSP_009524 | |||||
| Alternative sequence | 618 – 623 | 6 | ISLLHQ → MTFQHL in isoform 2. | VSP_009525 | |||||
| Alternative sequence | 642 – 673 | 32 | LAQAG…SVGPQ → MLLMAPDRCRYVWKHCQPME MRIKWIFLCCIR in isoform 3. | VSP_009526 | |||||
| Alternative sequence | 966 – 1286 | 321 | Missing in isoform 6. | VSP_009527 | |||||
| Natural variant | 32 | 1 | M → L. Ref.8 | VAR_065720 | |||||
| Natural variant | 96 | 1 | P → Q. Ref.10 Corresponds to variant rs1040904 [ dbSNP | Ensembl ]. | VAR_057772 | |||||
| Natural variant | 135 | 1 | S → R. Ref.8 | VAR_065721 | |||||
| Natural variant | 192 | 1 | K → E. Ref.10 Corresponds to variant rs6571751 [ dbSNP | Ensembl ]. | VAR_017830 | |||||
| Natural variant | 318 | 1 | A → V in a patient with primary open angle glaucoma. Ref.8 | VAR_065722 | |||||
| Natural variant | 363 | 1 | R → T in a patient with normal tension glaucoma. Ref.8 | VAR_065723 | |||||
| Natural variant | 432 | 1 | S → F Found in a patient with LCA6. Ref.10 | VAR_067184 | |||||
| Natural variant | 547 | 1 | A → S in CORD13. Ref.1 Ref.9 Corresponds to variant rs10151259 [ dbSNP | Ensembl ]. | VAR_017831 | |||||
| Natural variant | 585 | 1 | P → S. Ref.8 | VAR_065724 | |||||
| Natural variant | 589 | 1 | Q → H Does not affect the interaction with NPHP4. Ref.8 Corresponds to variant rs34067949 [ dbSNP | Ensembl ]. | VAR_065725 | |||||
| Natural variant | 598 | 1 | R → Q Found in patients with primary open angle glaucoma and juvenile open angle glaucoma; affects the interaction with NPHP4. Ref.8 Corresponds to variant rs74034910 [ dbSNP | Ensembl ]. | VAR_065726 | |||||
| Natural variant | 601 | 1 | S → L. Corresponds to variant rs3748360 [ dbSNP | Ensembl ]. | VAR_017832 | |||||
| Natural variant | 601 | 1 | S → W Found in a patient with LCA6. Ref.10 | VAR_067185 | |||||
| Natural variant | 603 | 1 | C → S. Ref.8 | VAR_065727 | |||||
| Natural variant | 631 | 1 | H → P in LCA6. Ref.10 | VAR_067186 | |||||
| Natural variant | 635 | 1 | A → G in a patient with normal tension glaucoma and a patient with primary open angle glaucoma; affects the interaction with NPHP4. Ref.8 | VAR_065728 | |||||
| Natural variant | 638 | 1 | T → I. Ref.8 | VAR_065729 | |||||
| Natural variant | 746 | 1 | G → E in LCA6. Ref.3 | VAR_017833 | |||||
| Natural variant | 764 | 1 | A → V Does not affect the interaction with NPHP4. Ref.8 | VAR_065730 | |||||
| Natural variant | 806 | 1 | T → I in a patient with primary open angle glaucoma who also carries variant K-352 in MYOC; affects the interaction with NPHP4. Ref.8 | VAR_065731 | |||||
| Natural variant | 812 | 1 | R → H Does not affect the interaction with NPHP4. Ref.8 | VAR_065732 | |||||
| Natural variant | 814 | 1 | R → L. Ref.8 | VAR_065733 | |||||
| Natural variant | 827 | 1 | R → L in CORD13. Ref.9 Corresponds to variant rs28937883 [ dbSNP | Ensembl ]. | VAR_017834 | |||||
| Natural variant | 837 | 1 | A → G in a patient with primary open angle glaucoma and a patient with juvenile open angle glaucoma; affects the interaction with NPHP4. Ref.8 | VAR_065734 | |||||
| Natural variant | 838 | 1 | I → V in a patient with normal tension glaucoma and a patient with primary open angle glaucoma; affects the interaction with NPHP4. Ref.8 | VAR_065735 | |||||
| Natural variant | 841 | 1 | A → T. Ref.8 | VAR_065736 | |||||
| Natural variant | 852 | 1 | R → Q. Ref.8 | VAR_065737 | |||||
| Natural variant | 883 | 1 | G → D. Ref.8 | VAR_065738 | |||||
| Natural variant | 960 | 1 | A → P. Corresponds to variant rs35810926 [ dbSNP | Ensembl ]. | VAR_057773 | |||||
| Natural variant | 1033 | 1 | E → Q. Ref.2 Ref.3 Ref.5 Ref.10 Corresponds to variant rs3748361 [ dbSNP | Ensembl ]. | VAR_017835 | |||||
| Natural variant | 1057 | 1 | H → L Found in a patient associated with LCA6. Ref.10 | VAR_067187 | |||||
| Natural variant | 1114 | 1 | D → G in LCA6. Ref.3 Corresponds to variant rs17103671 [ dbSNP | Ensembl ]. | VAR_017836 | |||||
| Natural variant | 1130 | 1 | E → Q Found in a patient with LCA6. Ref.11 | VAR_067188 | |||||
| Natural variant | 1240 | 1 | G → E. Corresponds to variant rs34725281 [ dbSNP | Ensembl ]. | VAR_057774 | |||||
Experimental info | |||||||||
| Sequence conflict | 539 | 1 | Missing in AAG10246. Ref.1 | ||||||
| Sequence conflict | 554 – 555 | 2 | HK → SQR in AAG10246. Ref.1 | ||||||
| Sequence conflict | 611 | 1 | G → R in CAE11866. Ref.6 | ||||||
| Sequence conflict | 1159 | 1 | P → L in CAE11866. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The retinitis pigmentosa GTPase regulator (RPGR) interacts with novel transport-like proteins in the outer segments of rod photoreceptors." Roepman R., Bernoud-Hubac N., Schick D.E., Maugeri A., Berger W., Ropers H.-H., Cremers F.P.M., Ferreira P.A. Hum. Mol. Genet. 9:2095-2105(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [MRNA] OF 525-1286 (ISOFORM 1), INTERACTION WITH RPGR, TISSUE SPECIFICITY, VARIANT CORD13 SER-547. Tissue: Retina. |
| [2] | "Identification of a novel protein interacting with RPGR." Boylan J.P., Wright A.F. Hum. Mol. Genet. 9:2085-2093(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5 AND 6), INTERACTION WITH RPGR, TISSUE SPECIFICITY, VARIANT GLN-1033. |
| [3] | "Complete exon-intron structure of the RPGR-interacting protein (RPGRIP1) gene allows the identification of mutations underlying Leber congenital amaurosis." Gerber S., Perrault I., Hanein S., Barbet F., Ducroq D., Ghazi I., Martin-Coignard D., Leowski C., Homfray T., Dufier J.-L., Munnich A., Kaplan J., Rozet J.-M. Eur. J. Hum. Genet. 9:561-571(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANTS LCA6 GLU-746 AND GLY-1114, VARIANT GLN-1033. |
| [4] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT GLN-1033. Tissue: Brain. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-1286 (ISOFORM 1). Tissue: Retina. |
| [7] | "Species-specific subcellular localization of RPGR and RPGRIP isoforms: implications for the phenotypic variability of congenital retinopathies among species." Mavlyutov T.A., Zhao H., Ferreira P.A. Hum. Mol. Genet. 11:1899-1907(2002) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "Evidence for RPGRIP1 gene as risk factor for primary open angle glaucoma." Fernandez-Martinez L., Letteboer S., Mardin C.Y., Weisschuh N., Gramer E., Weber B.H., Rautenstrauss B., Ferreira P.A., Kruse F.E., Reis A., Roepman R., Pasutto F. Eur. J. Hum. Genet. 19:445-451(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NPHP4, INVOLVEMENT IN GLAUCOMA, VARIANTS LEU-32; ARG-135; VAL-318; THR-363; SER-585; HIS-589; GLN-598; SER-603; GLY-635; ILE-638; VAL-764; ILE-806; HIS-812; LEU-814; GLY-837; VAL-838; THR-841; GLN-852 AND ASP-883, CHARACTERIZATION OF VARIANTS HIS-589; GLN-598; GLY-635; VAL-764; ILE-806; HIS-812; GLY-837 AND VAL-838. |
| [9] | "Evidence of RPGRIP1 gene mutations associated with recessive cone-rod dystrophy." Hameed A., Abid A., Aziz A., Ismail M., Mehdi S.Q., Khaliq S. J. Med. Genet. 40:616-619(2003) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS CORD13 SER-547 AND LEU-827. |
| [10] | "Molecular characterization of Leber congenital amaurosis in Koreans." Seong M.W., Kim S.Y., Yu Y.S., Hwang J.M., Kim J.Y., Park S.S. Mol. Vis. 14:1429-1436(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT LCA6 PRO-631, VARIANTS GLN-96; GLU-192; PHE-432; TRP-601; GLN-1033 AND LEU-1057. |
| [11] | "Detection of variants in 15 genes in 87 unrelated Chinese patients with Leber congenital amaurosis." Li L., Xiao X., Li S., Jia X., Wang P., Guo X., Jiao X., Zhang Q., Hejtmancik J.F. PLoS ONE 6:E19458-E19458(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT GLN-1130. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF227257 mRNA. Translation: AAG10246.1. AF265666 mRNA. Translation: AAG10000.1. AF265667 mRNA. Translation: AAG10001.1. AF260257 mRNA. Translation: AAF91371.1. AJ417048 AJ417066 Genomic DNA. Translation: CAD01136.1.AJ417067 mRNA. Translation: CAD01135.1. AL135744 Genomic DNA. No translation available. BC039089 mRNA. Translation: AAH39089.1. BX571740 mRNA. Translation: CAE11866.1. Different initiation. |
| IPI | IPI00179169. IPI00333327. IPI00401005. IPI00401006. IPI00401008. IPI01017877. |
| RefSeq | NP_065099.3. NM_020366.3. |
| UniGene | Hs.126035. |
3D structure databases | |
| ProteinModelPortal | Q96KN7. |
| SMR | Q96KN7. Positions 621-755, 799-909. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000382895. |
PTM databases | |
| PhosphoSite | Q96KN7. |
Polymorphism databases | |
| DMDM | 296452882. |
Proteomic databases | |
| PaxDb | Q96KN7. |
| PRIDE | Q96KN7. |
Protocols and materials databases | |
| DNASU | 57096. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000307974; ENSP00000309721; ENSG00000092200. ENST00000382933; ENSP00000372391; ENSG00000092200. ENST00000400017; ENSP00000382895; ENSG00000092200. |
| GeneID | 57096. |
| KEGG | hsa:57096. |
| UCSC | uc001wag.3. human. uc001wai.3. human. uc001wal.3. human. uc010aim.3. human. |
Organism-specific databases | |
| CTD | 57096. |
| GeneCards | GC14P021756. |
| HGNC | HGNC:13436. RPGRIP1. |
| HPA | HPA042955. |
| MIM | 605446. gene. 608194. phenotype. 613826. phenotype. |
| neXtProt | NX_Q96KN7. |
| Orphanet | 1872. Cone rod dystrophy. 65. Leber congenital amaurosis. 564. Meckel syndrome. |
| PharmGKB | PA34657. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG117461. |
| HOVERGEN | HBG060744. |
| InParanoid | Q96KN7. |
| KO | K16512. |
| OMA | EPGSYLG. |
| OrthoDB | EOG4933H8. |
Gene expression databases | |
| ArrayExpress | Q96KN7. |
| Bgee | Q96KN7. |
| CleanEx | HS_RPGRIP1. |
| Genevestigator | Q96KN7. |
| GermOnline | ENSG00000092200. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR021656. DUF3250. [Graphical view] |
| Pfam | PF11618. DUF3250. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. |
| PROSITE | PS50004. C2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 57096. |
| NextBio | 62917. |
| SOURCE | Search... |
Entry information
| Entry name | RPGR1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96KN7 Secondary accession number(s): Q7Z2W6 Q9NR40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
