Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96K19

- RN170_HUMAN

UniProt

Q96K19 - RN170_HUMAN

Protein

E3 ubiquitin-protein ligase RNF170

Gene

RNF170

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 2 (20 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells.1 Publication

    Pathwayi

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri87 – 13044RING-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. ligase activity Source: UniProtKB-KW
    2. zinc ion binding Source: InterPro

    GO - Biological processi

    1. protein ubiquitination Source: UniProtKB-UniPathway

    Keywords - Molecular functioni

    Ligase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    Metal-binding, Zinc

    Enzyme and pathway databases

    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    E3 ubiquitin-protein ligase RNF170 (EC:6.3.2.-)
    Alternative name(s):
    Putative LAG1-interacting protein
    RING finger protein 170
    Gene namesi
    Name:RNF170
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:25358. RNF170.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Ataxia, sensory, 1, autosomal dominant (SNAX1) [MIM:608984]: A rare disease characterized by progressive ataxia caused by degeneration of the posterior columns of the spinal cord. Affected individuals have a reduced ability to feel pain, temperature and vibration, particularly in the hands and feet. Their most prominent feature is an ataxic gait resulting from a severe loss of proprioception. Thus, patients rely on visual cues for maintaining proper body posture, such that they are unable to remain upright if their eyes are closed (Romberg sign).1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti199 – 1991R → C in SNAX1. 1 Publication
    VAR_068219

    Keywords - Diseasei

    Disease mutation

    Organism-specific databases

    MIMi608984. phenotype.
    PharmGKBiPA134922560.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 258258E3 ubiquitin-protein ligase RNF170PRO_0000280700Add
    BLAST

    Proteomic databases

    MaxQBiQ96K19.
    PaxDbiQ96K19.
    PRIDEiQ96K19.

    PTM databases

    PhosphoSiteiQ96K19.

    Expressioni

    Tissue specificityi

    Expressed in the spinal chord.1 Publication

    Gene expression databases

    ArrayExpressiQ96K19.
    BgeeiQ96K19.
    CleanExiHS_RNF170.
    GenevestigatoriQ96K19.

    Organism-specific databases

    HPAiHPA050931.
    HPA054621.

    Interactioni

    Subunit structurei

    Constitutively associated with the ERLIN1/ERLIN 2 complex. Interacts with activated ITPR1.1 Publication

    Protein-protein interaction databases

    BioGridi123583. 3 interactions.
    IntActiQ96K19. 1 interaction.
    MINTiMINT-4721277.
    STRINGi9606.ENSP00000240159.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96K19.
    SMRiQ96K19. Positions 84-130.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei25 – 4521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei202 – 22221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei224 – 24421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri87 – 13044RING-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Transmembrane, Transmembrane helix, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG294660.
    HOVERGENiHBG093906.
    InParanoidiQ96K19.
    KOiK15707.
    OMAiDMSCPVC.
    OrthoDBiEOG7WX0B3.
    PhylomeDBiQ96K19.
    TreeFamiTF328342.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR010652. DUF1232.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF06803. DUF1232. 1 hit.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view]
    SMARTiSM00184. RING. 1 hit.
    [Graphical view]
    PROSITEiPS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96K19-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKYQGEVQS LKLDDDSVIE GVSDQVLVAV VVSFALIATL VYALFRNVHQ    50
    NIHPENQELV RVLREQLQTE QDAPAATRQQ FYTDMYCPIC LHQASFPVET 100
    NCGHLFCGAC IIAYWRYGSW LGAISCPICR QTVTLLLTVF GEDDQSQDVL 150
    RLHQDINDYN RRFSGQPRSI MERIMDLPTL LRHAFREMFS VGGLFWMFRI 200
    RIILCLMGAF FYLISPLDFV PEALFGILGF LDDFFVIFLL LIYISIMYRE 250
    VITQRLTR 258
    Length:258
    Mass (Da):29,815
    Last modified:March 20, 2007 - v2
    Checksum:iD87C0B0C121AFD76
    GO
    Isoform 2 (identifier: Q96K19-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         170-258: IMERIMDLPT...REVITQRLTR → VSNAKACSKL...PRSLRPALET

    Note: No experimental confirmation available.

    Show »
    Length:236
    Mass (Da):26,650
    Checksum:iB3181176F62F3246
    GO
    Isoform 3 (identifier: Q96K19-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         133-200: VTLLLTVFGE...VGGLFWMFRI → GSSEKSSRAS...DCVSILWFSG
         201-258: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:200
    Mass (Da):22,154
    Checksum:iE4B6CC162D6B9078
    GO
    Isoform 4 (identifier: Q96K19-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: Missing.
         97-132: PVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT → MHLLPLDSSSTLTCTVPSACTKPPSRWRPTVDIFFV

    Note: No experimental confirmation available.

    Show »
    Length:162
    Mass (Da):18,950
    Checksum:iFA6744E40B8895E1
    GO
    Isoform 5 (identifier: Q96K19-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         109-116: ACIIAYWR → NLTPNSIW
         117-258: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:116
    Mass (Da):13,081
    Checksum:i10FE6D196964F4DE
    GO
    Isoform 6 (identifier: Q96K19-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-84: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:174
    Mass (Da):20,331
    Checksum:i28A727ABDFE770E9
    GO

    Sequence cautioni

    The sequence AAH39461.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence AAH44566.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti9 – 91Q → H in BAB55340. (PubMed:14702039)Curated
    Sequence conflicti74 – 741P → T in AAH44566. (PubMed:15489334)Curated
    Sequence conflicti97 – 971P → Q in AAH44566. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti199 – 1991R → C in SNAX1. 1 Publication
    VAR_068219

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 9696Missing in isoform 4. 1 PublicationVSP_023851Add
    BLAST
    Alternative sequencei1 – 8484Missing in isoform 6. 1 PublicationVSP_044556Add
    BLAST
    Alternative sequencei97 – 13236PVETN…ICRQT → MHLLPLDSSSTLTCTVPSAC TKPPSRWRPTVDIFFV in isoform 4. 1 PublicationVSP_023852Add
    BLAST
    Alternative sequencei109 – 1168ACIIAYWR → NLTPNSIW in isoform 5. 1 PublicationVSP_023853
    Alternative sequencei117 – 258142Missing in isoform 5. 1 PublicationVSP_023854Add
    BLAST
    Alternative sequencei133 – 20068VTLLL…WMFRI → GSSEKSSRASEQTHQEAVAC LDTQNSPACTVGCRSGPQHI PHDRMLPSASPRLCFTLLDC VSILWFSG in isoform 3. 1 PublicationVSP_023855Add
    BLAST
    Alternative sequencei170 – 25889IMERI…QRLTR → VSNAKACSKLEEDTFLLFCK VRFTNKYSLTMRNLGQAQWL APIVLALWEAKAGGSLEPRS LRPALET in isoform 2. 1 PublicationVSP_023856Add
    BLAST
    Alternative sequencei201 – 25858Missing in isoform 3. 1 PublicationVSP_023857Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027748 mRNA. Translation: BAB55340.1.
    AK090864 mRNA. Translation: BAC03534.1.
    AC009634 Genomic DNA. No translation available.
    AC087533 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63201.1.
    CH471080 Genomic DNA. Translation: EAW63203.1.
    BC013422 mRNA. Translation: AAH13422.1.
    BC032393 mRNA. Translation: AAH32393.1.
    BC039461 mRNA. Translation: AAH39461.1. Different initiation.
    BC044566 mRNA. Translation: AAH44566.1. Different initiation.
    BC058289 mRNA. No translation available.
    AL136620 mRNA. Translation: CAB66555.1.
    AF209504 mRNA. Translation: AAM92891.1.
    CCDSiCCDS55229.1. [Q96K19-6]
    CCDS55230.1. [Q96K19-3]
    CCDS6138.1. [Q96K19-1]
    RefSeqiNP_001153695.1. NM_001160223.1. [Q96K19-1]
    NP_001153696.1. NM_001160224.1. [Q96K19-3]
    NP_001153697.1. NM_001160225.1. [Q96K19-6]
    NP_112216.3. NM_030954.3. [Q96K19-1]
    XP_006716467.1. XM_006716404.1. [Q96K19-1]
    XP_006716469.1. XM_006716406.1. [Q96K19-6]
    UniGeneiHs.491626.

    Genome annotation databases

    EnsembliENST00000240159; ENSP00000240159; ENSG00000120925. [Q96K19-5]
    ENST00000319073; ENSP00000325969; ENSG00000120925. [Q96K19-4]
    ENST00000319104; ENSP00000326138; ENSG00000120925. [Q96K19-3]
    ENST00000526349; ENSP00000435782; ENSG00000120925. [Q96K19-6]
    ENST00000527424; ENSP00000434797; ENSG00000120925. [Q96K19-1]
    ENST00000534961; ENSP00000445725; ENSG00000120925. [Q96K19-1]
    GeneIDi81790.
    KEGGihsa:81790.
    UCSCiuc003xpm.3. human. [Q96K19-1]
    uc003xpn.3. human. [Q96K19-4]
    uc003xpq.4. human. [Q96K19-2]
    uc011lcx.2. human. [Q96K19-3]

    Polymorphism databases

    DMDMi134035027.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027748 mRNA. Translation: BAB55340.1 .
    AK090864 mRNA. Translation: BAC03534.1 .
    AC009634 Genomic DNA. No translation available.
    AC087533 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63201.1 .
    CH471080 Genomic DNA. Translation: EAW63203.1 .
    BC013422 mRNA. Translation: AAH13422.1 .
    BC032393 mRNA. Translation: AAH32393.1 .
    BC039461 mRNA. Translation: AAH39461.1 . Different initiation.
    BC044566 mRNA. Translation: AAH44566.1 . Different initiation.
    BC058289 mRNA. No translation available.
    AL136620 mRNA. Translation: CAB66555.1 .
    AF209504 mRNA. Translation: AAM92891.1 .
    CCDSi CCDS55229.1. [Q96K19-6 ]
    CCDS55230.1. [Q96K19-3 ]
    CCDS6138.1. [Q96K19-1 ]
    RefSeqi NP_001153695.1. NM_001160223.1. [Q96K19-1 ]
    NP_001153696.1. NM_001160224.1. [Q96K19-3 ]
    NP_001153697.1. NM_001160225.1. [Q96K19-6 ]
    NP_112216.3. NM_030954.3. [Q96K19-1 ]
    XP_006716467.1. XM_006716404.1. [Q96K19-1 ]
    XP_006716469.1. XM_006716406.1. [Q96K19-6 ]
    UniGenei Hs.491626.

    3D structure databases

    ProteinModelPortali Q96K19.
    SMRi Q96K19. Positions 84-130.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123583. 3 interactions.
    IntActi Q96K19. 1 interaction.
    MINTi MINT-4721277.
    STRINGi 9606.ENSP00000240159.

    PTM databases

    PhosphoSitei Q96K19.

    Polymorphism databases

    DMDMi 134035027.

    Proteomic databases

    MaxQBi Q96K19.
    PaxDbi Q96K19.
    PRIDEi Q96K19.

    Protocols and materials databases

    DNASUi 81790.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000240159 ; ENSP00000240159 ; ENSG00000120925 . [Q96K19-5 ]
    ENST00000319073 ; ENSP00000325969 ; ENSG00000120925 . [Q96K19-4 ]
    ENST00000319104 ; ENSP00000326138 ; ENSG00000120925 . [Q96K19-3 ]
    ENST00000526349 ; ENSP00000435782 ; ENSG00000120925 . [Q96K19-6 ]
    ENST00000527424 ; ENSP00000434797 ; ENSG00000120925 . [Q96K19-1 ]
    ENST00000534961 ; ENSP00000445725 ; ENSG00000120925 . [Q96K19-1 ]
    GeneIDi 81790.
    KEGGi hsa:81790.
    UCSCi uc003xpm.3. human. [Q96K19-1 ]
    uc003xpn.3. human. [Q96K19-4 ]
    uc003xpq.4. human. [Q96K19-2 ]
    uc011lcx.2. human. [Q96K19-3 ]

    Organism-specific databases

    CTDi 81790.
    GeneCardsi GC08M042705.
    HGNCi HGNC:25358. RNF170.
    HPAi HPA050931.
    HPA054621.
    MIMi 608984. phenotype.
    614649. gene.
    neXtProti NX_Q96K19.
    PharmGKBi PA134922560.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG294660.
    HOVERGENi HBG093906.
    InParanoidi Q96K19.
    KOi K15707.
    OMAi DMSCPVC.
    OrthoDBi EOG7WX0B3.
    PhylomeDBi Q96K19.
    TreeFami TF328342.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .

    Miscellaneous databases

    GenomeRNAii 81790.
    NextBioi 72096.
    PROi Q96K19.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96K19.
    Bgeei Q96K19.
    CleanExi HS_RNF170.
    Genevestigatori Q96K19.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR010652. DUF1232.
    IPR018957. Znf_C3HC4_RING-type.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF06803. DUF1232. 1 hit.
    PF00097. zf-C3HC4. 1 hit.
    [Graphical view ]
    SMARTi SM00184. RING. 1 hit.
    [Graphical view ]
    PROSITEi PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
      Tissue: Amygdala and Placenta.
    2. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 5 AND 6).
      Tissue: Brain, Lung, Pancreas and Placenta.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-167 (ISOFORM 1).
      Tissue: Brain.
    6. "Interactors of a human homolog of yeast LAG1 gene."
      Pan H., Xu Z.G., Huo K.K., Li Y.Y.
      Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 140-258 (ISOFORM 1).
      Tissue: Fetal brain.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "RNF170 protein, an endoplasmic reticulum membrane ubiquitin ligase, mediates inositol 1,4,5-trisphosphate receptor ubiquitination and degradation."
      Lu J.P., Wang Y., Sliter D.A., Pearce M.M., Wojcikiewicz R.J.
      J. Biol. Chem. 286:24426-24433(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH ERLIN1/ERLIN2 COMPLEX AND ITPR1.
    9. Cited for: VARIANT SNAX1 CYS-199, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiRN170_HUMAN
    AccessioniPrimary (citable) accession number: Q96K19
    Secondary accession number(s): D3DSY6
    , E9PIL4, Q7Z483, Q86YC0, Q8IXR7, Q8N2B5, Q8N5G9, Q8NG30, Q9H0V6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 2007
    Last sequence update: March 20, 2007
    Last modified: October 1, 2014
    This is version 94 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3