SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96K19

- RN170_HUMAN

UniProt

Q96K19 - RN170_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
E3 ubiquitin-protein ligase RNF170
Gene
RNF170
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells.1 Publication

Pathwayi

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri87 – 13044RING-type
Add
BLAST

GO - Molecular functioni

  1. ligase activity Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. protein ubiquitination Source: UniProtKB-UniPathway
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase RNF170 (EC:6.3.2.-)
Alternative name(s):
Putative LAG1-interacting protein
RING finger protein 170
Gene namesi
Name:RNF170
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:25358. RNF170.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei25 – 4521Helical; Reviewed prediction
Add
BLAST
Transmembranei202 – 22221Helical; Reviewed prediction
Add
BLAST
Transmembranei224 – 24421Helical; Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Involvement in diseasei

Ataxia, sensory, 1, autosomal dominant (SNAX1) [MIM:608984]: A rare disease characterized by progressive ataxia caused by degeneration of the posterior columns of the spinal cord. Affected individuals have a reduced ability to feel pain, temperature and vibration, particularly in the hands and feet. Their most prominent feature is an ataxic gait resulting from a severe loss of proprioception. Thus, patients rely on visual cues for maintaining proper body posture, such that they are unable to remain upright if their eyes are closed (Romberg sign).
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti199 – 1991R → C in SNAX1. 1 Publication
VAR_068219

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi608984. phenotype.
PharmGKBiPA134922560.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 258258E3 ubiquitin-protein ligase RNF170
PRO_0000280700Add
BLAST

Proteomic databases

MaxQBiQ96K19.
PaxDbiQ96K19.
PRIDEiQ96K19.

PTM databases

PhosphoSiteiQ96K19.

Expressioni

Tissue specificityi

Expressed in the spinal chord.1 Publication

Gene expression databases

ArrayExpressiQ96K19.
BgeeiQ96K19.
CleanExiHS_RNF170.
GenevestigatoriQ96K19.

Organism-specific databases

HPAiHPA050931.
HPA054621.

Interactioni

Subunit structurei

Constitutively associated with the ERLIN1/ERLIN 2 complex. Interacts with activated ITPR1.1 Publication

Protein-protein interaction databases

BioGridi123583. 3 interactions.
IntActiQ96K19. 1 interaction.
MINTiMINT-4721277.
STRINGi9606.ENSP00000240159.

Structurei

3D structure databases

ProteinModelPortaliQ96K19.
SMRiQ96K19. Positions 84-130.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiNOG294660.
HOVERGENiHBG093906.
InParanoidiQ96K19.
KOiK15707.
OMAiDMSCPVC.
OrthoDBiEOG7WX0B3.
PhylomeDBiQ96K19.
TreeFamiTF328342.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR010652. DUF1232.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF06803. DUF1232. 1 hit.
PF00097. zf-C3HC4. 1 hit.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96K19-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAKYQGEVQS LKLDDDSVIE GVSDQVLVAV VVSFALIATL VYALFRNVHQ    50
NIHPENQELV RVLREQLQTE QDAPAATRQQ FYTDMYCPIC LHQASFPVET 100
NCGHLFCGAC IIAYWRYGSW LGAISCPICR QTVTLLLTVF GEDDQSQDVL 150
RLHQDINDYN RRFSGQPRSI MERIMDLPTL LRHAFREMFS VGGLFWMFRI 200
RIILCLMGAF FYLISPLDFV PEALFGILGF LDDFFVIFLL LIYISIMYRE 250
VITQRLTR 258
Length:258
Mass (Da):29,815
Last modified:March 20, 2007 - v2
Checksum:iD87C0B0C121AFD76
GO
Isoform 2 (identifier: Q96K19-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     170-258: IMERIMDLPT...REVITQRLTR → VSNAKACSKL...PRSLRPALET

Note: No experimental confirmation available.

Show »
Length:236
Mass (Da):26,650
Checksum:iB3181176F62F3246
GO
Isoform 3 (identifier: Q96K19-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-200: VTLLLTVFGE...VGGLFWMFRI → GSSEKSSRAS...DCVSILWFSG
     201-258: Missing.

Note: No experimental confirmation available.

Show »
Length:200
Mass (Da):22,154
Checksum:iE4B6CC162D6B9078
GO
Isoform 4 (identifier: Q96K19-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.
     97-132: PVETNCGHLFCGACIIAYWRYGSWLGAISCPICRQT → MHLLPLDSSSTLTCTVPSACTKPPSRWRPTVDIFFV

Note: No experimental confirmation available.

Show »
Length:162
Mass (Da):18,950
Checksum:iFA6744E40B8895E1
GO
Isoform 5 (identifier: Q96K19-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-116: ACIIAYWR → NLTPNSIW
     117-258: Missing.

Note: No experimental confirmation available.

Show »
Length:116
Mass (Da):13,081
Checksum:i10FE6D196964F4DE
GO
Isoform 6 (identifier: Q96K19-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-84: Missing.

Note: No experimental confirmation available.

Show »
Length:174
Mass (Da):20,331
Checksum:i28A727ABDFE770E9
GO

Sequence cautioni

The sequence AAH39461.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence AAH44566.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti199 – 1991R → C in SNAX1. 1 Publication
VAR_068219

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 9696Missing in isoform 4.
VSP_023851Add
BLAST
Alternative sequencei1 – 8484Missing in isoform 6.
VSP_044556Add
BLAST
Alternative sequencei97 – 13236PVETN…ICRQT → MHLLPLDSSSTLTCTVPSAC TKPPSRWRPTVDIFFV in isoform 4.
VSP_023852Add
BLAST
Alternative sequencei109 – 1168ACIIAYWR → NLTPNSIW in isoform 5.
VSP_023853
Alternative sequencei117 – 258142Missing in isoform 5.
VSP_023854Add
BLAST
Alternative sequencei133 – 20068VTLLL…WMFRI → GSSEKSSRASEQTHQEAVAC LDTQNSPACTVGCRSGPQHI PHDRMLPSASPRLCFTLLDC VSILWFSG in isoform 3.
VSP_023855Add
BLAST
Alternative sequencei170 – 25889IMERI…QRLTR → VSNAKACSKLEEDTFLLFCK VRFTNKYSLTMRNLGQAQWL APIVLALWEAKAGGSLEPRS LRPALET in isoform 2.
VSP_023856Add
BLAST
Alternative sequencei201 – 25858Missing in isoform 3.
VSP_023857Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti9 – 91Q → H in BAB55340. 1 Publication
Sequence conflicti74 – 741P → T in AAH44566. 1 Publication
Sequence conflicti97 – 971P → Q in AAH44566. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK027748 mRNA. Translation: BAB55340.1.
AK090864 mRNA. Translation: BAC03534.1.
AC009634 Genomic DNA. No translation available.
AC087533 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63201.1.
CH471080 Genomic DNA. Translation: EAW63203.1.
BC013422 mRNA. Translation: AAH13422.1.
BC032393 mRNA. Translation: AAH32393.1.
BC039461 mRNA. Translation: AAH39461.1. Different initiation.
BC044566 mRNA. Translation: AAH44566.1. Different initiation.
BC058289 mRNA. No translation available.
AL136620 mRNA. Translation: CAB66555.1.
AF209504 mRNA. Translation: AAM92891.1.
CCDSiCCDS55229.1. [Q96K19-6]
CCDS55230.1. [Q96K19-3]
CCDS6138.1. [Q96K19-1]
RefSeqiNP_001153695.1. NM_001160223.1. [Q96K19-1]
NP_001153696.1. NM_001160224.1. [Q96K19-3]
NP_001153697.1. NM_001160225.1. [Q96K19-6]
NP_112216.3. NM_030954.3. [Q96K19-1]
XP_006716467.1. XM_006716404.1. [Q96K19-1]
XP_006716469.1. XM_006716406.1. [Q96K19-6]
UniGeneiHs.491626.

Genome annotation databases

EnsembliENST00000240159; ENSP00000240159; ENSG00000120925. [Q96K19-5]
ENST00000319073; ENSP00000325969; ENSG00000120925. [Q96K19-4]
ENST00000319104; ENSP00000326138; ENSG00000120925. [Q96K19-3]
ENST00000526349; ENSP00000435782; ENSG00000120925. [Q96K19-6]
ENST00000527424; ENSP00000434797; ENSG00000120925. [Q96K19-1]
ENST00000534961; ENSP00000445725; ENSG00000120925. [Q96K19-1]
GeneIDi81790.
KEGGihsa:81790.
UCSCiuc003xpm.3. human. [Q96K19-1]
uc003xpn.3. human. [Q96K19-4]
uc003xpq.4. human. [Q96K19-2]
uc011lcx.2. human. [Q96K19-3]

Polymorphism databases

DMDMi134035027.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK027748 mRNA. Translation: BAB55340.1 .
AK090864 mRNA. Translation: BAC03534.1 .
AC009634 Genomic DNA. No translation available.
AC087533 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63201.1 .
CH471080 Genomic DNA. Translation: EAW63203.1 .
BC013422 mRNA. Translation: AAH13422.1 .
BC032393 mRNA. Translation: AAH32393.1 .
BC039461 mRNA. Translation: AAH39461.1 . Different initiation.
BC044566 mRNA. Translation: AAH44566.1 . Different initiation.
BC058289 mRNA. No translation available.
AL136620 mRNA. Translation: CAB66555.1 .
AF209504 mRNA. Translation: AAM92891.1 .
CCDSi CCDS55229.1. [Q96K19-6 ]
CCDS55230.1. [Q96K19-3 ]
CCDS6138.1. [Q96K19-1 ]
RefSeqi NP_001153695.1. NM_001160223.1. [Q96K19-1 ]
NP_001153696.1. NM_001160224.1. [Q96K19-3 ]
NP_001153697.1. NM_001160225.1. [Q96K19-6 ]
NP_112216.3. NM_030954.3. [Q96K19-1 ]
XP_006716467.1. XM_006716404.1. [Q96K19-1 ]
XP_006716469.1. XM_006716406.1. [Q96K19-6 ]
UniGenei Hs.491626.

3D structure databases

ProteinModelPortali Q96K19.
SMRi Q96K19. Positions 84-130.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123583. 3 interactions.
IntActi Q96K19. 1 interaction.
MINTi MINT-4721277.
STRINGi 9606.ENSP00000240159.

PTM databases

PhosphoSitei Q96K19.

Polymorphism databases

DMDMi 134035027.

Proteomic databases

MaxQBi Q96K19.
PaxDbi Q96K19.
PRIDEi Q96K19.

Protocols and materials databases

DNASUi 81790.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000240159 ; ENSP00000240159 ; ENSG00000120925 . [Q96K19-5 ]
ENST00000319073 ; ENSP00000325969 ; ENSG00000120925 . [Q96K19-4 ]
ENST00000319104 ; ENSP00000326138 ; ENSG00000120925 . [Q96K19-3 ]
ENST00000526349 ; ENSP00000435782 ; ENSG00000120925 . [Q96K19-6 ]
ENST00000527424 ; ENSP00000434797 ; ENSG00000120925 . [Q96K19-1 ]
ENST00000534961 ; ENSP00000445725 ; ENSG00000120925 . [Q96K19-1 ]
GeneIDi 81790.
KEGGi hsa:81790.
UCSCi uc003xpm.3. human. [Q96K19-1 ]
uc003xpn.3. human. [Q96K19-4 ]
uc003xpq.4. human. [Q96K19-2 ]
uc011lcx.2. human. [Q96K19-3 ]

Organism-specific databases

CTDi 81790.
GeneCardsi GC08M042705.
HGNCi HGNC:25358. RNF170.
HPAi HPA050931.
HPA054621.
MIMi 608984. phenotype.
614649. gene.
neXtProti NX_Q96K19.
PharmGKBi PA134922560.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG294660.
HOVERGENi HBG093906.
InParanoidi Q96K19.
KOi K15707.
OMAi DMSCPVC.
OrthoDBi EOG7WX0B3.
PhylomeDBi Q96K19.
TreeFami TF328342.

Enzyme and pathway databases

UniPathwayi UPA00143 .

Miscellaneous databases

GenomeRNAii 81790.
NextBioi 72096.
PROi Q96K19.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96K19.
Bgeei Q96K19.
CleanExi HS_RNF170.
Genevestigatori Q96K19.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR010652. DUF1232.
IPR018957. Znf_C3HC4_RING-type.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF06803. DUF1232. 1 hit.
PF00097. zf-C3HC4. 1 hit.
[Graphical view ]
SMARTi SM00184. RING. 1 hit.
[Graphical view ]
PROSITEi PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4).
    Tissue: Amygdala and Placenta.
  2. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 5 AND 6).
    Tissue: Brain, Lung, Pancreas and Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-167 (ISOFORM 1).
    Tissue: Brain.
  6. "Interactors of a human homolog of yeast LAG1 gene."
    Pan H., Xu Z.G., Huo K.K., Li Y.Y.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 140-258 (ISOFORM 1).
    Tissue: Fetal brain.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "RNF170 protein, an endoplasmic reticulum membrane ubiquitin ligase, mediates inositol 1,4,5-trisphosphate receptor ubiquitination and degradation."
    Lu J.P., Wang Y., Sliter D.A., Pearce M.M., Wojcikiewicz R.J.
    J. Biol. Chem. 286:24426-24433(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ERLIN1/ERLIN2 COMPLEX AND ITPR1.
  9. Cited for: VARIANT SNAX1 CYS-199, TISSUE SPECIFICITY.

Entry informationi

Entry nameiRN170_HUMAN
AccessioniPrimary (citable) accession number: Q96K19
Secondary accession number(s): D3DSY6
, E9PIL4, Q7Z483, Q86YC0, Q8IXR7, Q8N2B5, Q8N5G9, Q8NG30, Q9H0V6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: July 9, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi