Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96JY6 (PDLI2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 110. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
PDZ and LIM domain protein 2
Alternative name(s):
PDZ-LIM protein mystique
Gene names
Name:PDLIM2
ORF Names:PP6345
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length352 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity. Ref.10

Subunit structure

Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9 By similarity.

Subcellular location

Cytoplasm. Nucleus. Note: May be partially nuclear. Ref.10

Isoform 1: Cytoplasmcytoskeleton. Note: Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin (PXN). Ref.10

Isoform 2: Cytoplasmcytoskeleton Ref.10.

Isoform 3: Nucleus Ref.10.

Sequence similarities

Contains 1 LIM zinc-binding domain.

Contains 1 PDZ (DHR) domain.

Sequence caution

The sequence AAG16633.1 differs from that shown. Reason: Frameshift at position 131.

The sequence AAL55747.1 differs from that shown. Reason: Frameshift at positions 42 and 207.

The sequence AAL65265.1 differs from that shown. Reason: Frameshift at position 237.

The sequence BAB15788.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentCytoplasm
Cytoskeleton
Nucleus
   Coding sequence diversityAlternative splicing
   DomainLIM domain
   LigandMetal-binding
Zinc
   PTMPhosphoprotein
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentactin cytoskeleton

Inferred from direct assay. Source: HPA

cytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

focal adhesion

Inferred from direct assay. Source: HPA

nucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionzinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96JY6-1)

Also known as: Mystique 2;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96JY6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG
     225-352: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96JY6-3)

Also known as: Mystique 1;

The sequence of this isoform differs from the canonical sequence as follows:
     328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW
Isoform 4 (identifier: Q96JY6-4)

Also known as: Mystique 3;

The sequence of this isoform differs from the canonical sequence as follows:
     256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG
Isoform 5 (identifier: Q96JY6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGGRARPAW...AESTDRLKGM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 352352PDZ and LIM domain protein 2
PRO_0000075862

Regions

Domain1 – 8484PDZ
Domain284 – 34461LIM zinc-binding
Compositional bias114 – 16148Ser-rich

Amino acid modifications

Modified residue1971Phosphoserine By similarity

Natural variations

Alternative sequence11M → MRGGRARPAWESFMGLPPRS SAKWGAGQSLDRLCCAPGSR GLAGAPGRMRAPPAGRSQPA GGPGDSLPHPPGGLGPGGSA WARRAEAAASRARGGGRGGP GITWAEAGPGAPGGLSPESG RRQRERWRLPAFPPSRAWAP SRTGERQPGERAHLRLSARP ALPGAGLLSAPLSARNPGLV RGPAPWSLASAGAPPRAALS PAGALLLQPPARRVLCPRSE GGSRTGRAGPSGWAPPRGAR SAESTDRLKGM in isoform 5.
VSP_047113
Alternative sequence154 – 22471SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2.
VSP_014058
Alternative sequence225 – 352128Missing in isoform 2.
VSP_014059
Alternative sequence256 – 35297GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4.
VSP_014060
Alternative sequence328 – 35225VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3.
VSP_014061

Experimental info

Mutagenesis801L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. Ref.10
Mutagenesis3131C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. Ref.10
Mutagenesis3161C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. Ref.10
Sequence conflict911T → N in AAG16633. Ref.1
Sequence conflict1161S → F in AAG16633. Ref.1
Sequence conflict1491A → R in AAL55747. Ref.4

Secondary structure

.................... 352
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (Mystique 2) [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: E36EC66C61C5E9DB

FASTA35237,459
        10         20         30         40         50         60 
MALTVDVAGP APWGFRITGG RDFHTPIMVT KVAERGKAKD ADLRPGDIIV AINGESAEGM 

        70         80         90        100        110        120 
LHAEAQSKIR QSPSPLRLQL DRSQATSPGQ TNGDSSLEVL ATRFQGSVRT YTESQSSLRS 

       130        140        150        160        170        180 
SYSSPTSLSP RAGSPFSPPP SSSSLTGEAA ISRSFQSLAC SPGLPAADRL SYSGRPGSRQ 

       190        200        210        220        230        240 
AGLGRAGDSA VLVLPPSPGP RSSRPSMDSE GGSLLLDEDS EVFKMLQENR EGRAAPRQSS 

       250        260        270        280        290        300 
SFRLLQEALE AEERGGTPAF LPSSLSPQSS LPASRALATP PKLHTCEKCS TSIANQAVRI 

       310        320        330        340        350 
QEGRYRHPGC YTCADCGLNL KMRGHFWVGD ELYCEKHARQ RYSAPATLSS RA 

« Hide

Isoform 2 [UniParc].

Checksum: F4C39E4F01144F52
Show »

FASTA22423,073
Isoform 3 (Mystique 1) [UniParc].

Checksum: 739E0BB65889B1F6
Show »

FASTA36639,181
Isoform 4 (Mystique 3) [UniParc].

Checksum: F3D480E6DEAD66E9
Show »

FASTA27829,105
Isoform 5 [UniParc].

Checksum: FCA292BEEBB24930
Show »

FASTA60262,746

References

« Hide 'large scale' references
[1]"Mystique, a PDZ-LIM protein with one carboxyl terminal LIM domain."
Lau Y.M., Kotaka M., Chan A.H., Lee S.M.Y., Au C.C., Chim S.S.C., Kok L.D.S., Ng E.K.O., Siu S.S., Yiu S.W.H., Fung K.P., Waye M.M.Y., Tsui S.K.W., Lee C.Y.
Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[2]Guo J.H., Zan Q., Yu L.
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Hypothalamus.
[3]"Cloning a novel protein containing PDZ and LIM domains."
Shan Y.X., Yu L., Huang C.Q.
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[4]"Large-scale cDNA transfection screening for genes related to cancer development and progression."
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. expand/collapse author list , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[5]"Characterization of long cDNA clones from human adult spleen."
Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Spleen.
[6]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta and Spleen.
[7]"DNA sequence and analysis of human chromosome 8."
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. expand/collapse author list , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Placenta.
[10]"Mystique is a new IGF-I regulated PDZ-LIM domain protein that promotes cell attachment and migration and suppresses anchorage independent growth."
Loughran G., Healy N., Kiely P.A., Huigsloot M., Kedersha N.L., O'connor R.
Mol. Biol. Cell 16:1811-1822(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-80; CYS-313 AND CYS-316.
[11]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[12]"Structure of the PDZ domain of human PDLIM2 bound to a C-terminal extension from human beta-tropomyosin."
Structural genomics consortium (SGC)
Submitted (FEB-2009) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 1-82.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY007729 mRNA. Translation: AAG16633.1. Frameshift.
AY070438 mRNA. Translation: AAL65265.1. Frameshift.
AY217349 mRNA. Translation: AAO45102.1.
AF289563 mRNA. Translation: AAL55747.1. Frameshift.
AK024498 mRNA. Translation: BAB15788.1. Different initiation.
AK027800 mRNA. Translation: BAB55378.1.
AC037459 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63667.1.
CH471080 Genomic DNA. Translation: EAW63669.1.
BC021556 mRNA. Translation: AAH21556.1.
BC071774 mRNA. Translation: AAH71774.1.
CCDSCCDS34860.1. [Q96JY6-3]
CCDS34861.1. [Q96JY6-4]
CCDS6032.2. [Q96JY6-5]
RefSeqNP_067643.3. NM_021630.5. [Q96JY6-5]
NP_789847.1. NM_176871.3. [Q96JY6-3]
NP_932159.1. NM_198042.3. [Q96JY6-4]
UniGeneHs.632034.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2PA1X-ray1.70A1-82[»]
3PDVX-ray2.20A1-83[»]
ProteinModelPortalQ96JY6.
SMRQ96JY6. Positions 1-82, 282-347.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122122. 4 interactions.
STRING9606.ENSP00000265810.

PTM databases

PhosphoSiteQ96JY6.

Polymorphism databases

DMDM67461069.

Proteomic databases

MaxQBQ96JY6.
PaxDbQ96JY6.
PRIDEQ96JY6.

Protocols and materials databases

DNASU64236.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000265810; ENSP00000265810; ENSG00000120913. [Q96JY6-3]
ENST00000308354; ENSP00000312634; ENSG00000120913. [Q96JY6-5]
ENST00000339162; ENSP00000342035; ENSG00000120913. [Q96JY6-4]
ENST00000397760; ENSP00000380867; ENSG00000120913. [Q96JY6-1]
ENST00000397761; ENSP00000380868; ENSG00000120913. [Q96JY6-1]
ENST00000409141; ENSP00000386868; ENSG00000120913. [Q96JY6-4]
ENST00000409417; ENSP00000387084; ENSG00000120913. [Q96JY6-1]
GeneID64236.
KEGGhsa:64236.
UCSCuc003xca.3. human. [Q96JY6-4]
uc003xcc.2. human. [Q96JY6-3]

Organism-specific databases

CTD64236.
GeneCardsGC08P022435.
HGNCHGNC:13992. PDLIM2.
HPAHPA003880.
MIM609722. gene.
neXtProtNX_Q96JY6.
PharmGKBPA33159.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG246155.
HOGENOMHOG000290704.
HOVERGENHBG061371.
OMAFQSLAHS.
OrthoDBEOG77DJ69.
PhylomeDBQ96JY6.
TreeFamTF106408.

Gene expression databases

ArrayExpressQ96JY6.
BgeeQ96JY6.
CleanExHS_PDLIM2.
GenevestigatorQ96JY6.

Family and domain databases

Gene3D2.10.110.10. 1 hit.
2.30.42.10. 1 hit.
InterProIPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamPF00412. LIM. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTSM00132. LIM. 1 hit.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMSSF50156. SSF50156. 1 hit.
PROSITEPS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ96JY6.
GeneWikiPDLIM2.
GenomeRNAi64236.
NextBio35534917.
PROQ96JY6.
SOURCESearch...

Entry information

Entry namePDLI2_HUMAN
AccessionPrimary (citable) accession number: Q96JY6
Secondary accession number(s): D3DSR5 expand/collapse secondary AC list , J3KNH4, Q7Z584, Q86WM8, Q8WZ29, Q9H4L9, Q9H7I2
Entry history
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM