Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JY6

- PDLI2_HUMAN

UniProt

Q96JY6 - PDLI2_HUMAN

Protein

PDZ and LIM domain protein 2

Gene

PDLIM2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.1 Publication

    GO - Molecular functioni

    1. zinc ion binding Source: InterPro

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PDZ and LIM domain protein 2
    Alternative name(s):
    PDZ-LIM protein mystique
    Gene namesi
    Name:PDLIM2
    ORF Names:PP6345
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:13992. PDLIM2.

    Subcellular locationi

    Cytoplasm 1 Publication. Nucleus 1 Publication
    Note: May be partially nuclear.
    Isoform 1 : Cytoplasmcytoskeleton
    Note: Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin (PXN).

    GO - Cellular componenti

    1. actin cytoskeleton Source: HPA
    2. cytoplasm Source: UniProtKB-SubCell
    3. extracellular vesicular exosome Source: UniProt
    4. focal adhesion Source: HPA
    5. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi80 – 801L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. 1 Publication
    Mutagenesisi313 – 3131C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. 1 Publication
    Mutagenesisi316 – 3161C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. 1 Publication

    Organism-specific databases

    PharmGKBiPA33159.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 352352PDZ and LIM domain protein 2PRO_0000075862Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei197 – 1971PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ96JY6.
    PaxDbiQ96JY6.
    PRIDEiQ96JY6.

    PTM databases

    PhosphoSiteiQ96JY6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96JY6.
    BgeeiQ96JY6.
    CleanExiHS_PDLIM2.
    GenevestigatoriQ96JY6.

    Organism-specific databases

    HPAiHPA003880.

    Interactioni

    Subunit structurei

    Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9.By similarity

    Protein-protein interaction databases

    BioGridi122122. 4 interactions.
    STRINGi9606.ENSP00000265810.

    Structurei

    Secondary structure

    352
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi1 – 77
    Beta strandi9 – 113
    Beta strandi14 – 207
    Helixi21 – 233
    Beta strandi25 – 328
    Beta strandi34 – 363
    Helixi37 – 404
    Beta strandi48 – 525
    Beta strandi55 – 573
    Helixi62 – 709
    Beta strandi74 – 829

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2PA1X-ray1.70A1-82[»]
    3PDVX-ray2.20A1-83[»]
    ProteinModelPortaliQ96JY6.
    SMRiQ96JY6. Positions 1-82, 282-347.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96JY6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 8484PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini284 – 34461LIM zinc-bindingPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi114 – 16148Ser-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 LIM zinc-binding domain.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    LIM domain

    Phylogenomic databases

    eggNOGiNOG246155.
    HOGENOMiHOG000290704.
    HOVERGENiHBG061371.
    OMAiFQSLAHS.
    OrthoDBiEOG77DJ69.
    PhylomeDBiQ96JY6.
    TreeFamiTF106408.

    Family and domain databases

    Gene3Di2.10.110.10. 1 hit.
    2.30.42.10. 1 hit.
    InterProiIPR001478. PDZ.
    IPR001781. Znf_LIM.
    [Graphical view]
    PfamiPF00412. LIM. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view]
    SMARTiSM00132. LIM. 1 hit.
    SM00228. PDZ. 1 hit.
    [Graphical view]
    SUPFAMiSSF50156. SSF50156. 1 hit.
    PROSITEiPS00478. LIM_DOMAIN_1. 1 hit.
    PS50023. LIM_DOMAIN_2. 1 hit.
    PS50106. PDZ. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JY6-1) [UniParc]FASTAAdd to Basket

    Also known as: Mystique 2

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MALTVDVAGP APWGFRITGG RDFHTPIMVT KVAERGKAKD ADLRPGDIIV    50
    AINGESAEGM LHAEAQSKIR QSPSPLRLQL DRSQATSPGQ TNGDSSLEVL 100
    ATRFQGSVRT YTESQSSLRS SYSSPTSLSP RAGSPFSPPP SSSSLTGEAA 150
    ISRSFQSLAC SPGLPAADRL SYSGRPGSRQ AGLGRAGDSA VLVLPPSPGP 200
    RSSRPSMDSE GGSLLLDEDS EVFKMLQENR EGRAAPRQSS SFRLLQEALE 250
    AEERGGTPAF LPSSLSPQSS LPASRALATP PKLHTCEKCS TSIANQAVRI 300
    QEGRYRHPGC YTCADCGLNL KMRGHFWVGD ELYCEKHARQ RYSAPATLSS 350
    RA 352
    Length:352
    Mass (Da):37,459
    Last modified:December 1, 2001 - v1
    Checksum:iE36EC66C61C5E9DB
    GO
    Isoform 2 (identifier: Q96JY6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG
         225-352: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:224
    Mass (Da):23,073
    Checksum:iF4C39E4F01144F52
    GO
    Isoform 3 (identifier: Q96JY6-3) [UniParc]FASTAAdd to Basket

    Also known as: Mystique 1

    The sequence of this isoform differs from the canonical sequence as follows:
         328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW

    Show »
    Length:366
    Mass (Da):39,181
    Checksum:i739E0BB65889B1F6
    GO
    Isoform 4 (identifier: Q96JY6-4) [UniParc]FASTAAdd to Basket

    Also known as: Mystique 3

    The sequence of this isoform differs from the canonical sequence as follows:
         256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG

    Show »
    Length:278
    Mass (Da):29,105
    Checksum:iF3D480E6DEAD66E9
    GO
    Isoform 5 (identifier: Q96JY6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRGGRARPAW...AESTDRLKGM

    Show »
    Length:602
    Mass (Da):62,746
    Checksum:iFCA292BEEBB24930
    GO

    Sequence cautioni

    The sequence AAG16633.1 differs from that shown. Reason: Frameshift at position 131.
    The sequence AAL55747.1 differs from that shown. Reason: Frameshift at positions 42 and 207.
    The sequence AAL65265.1 differs from that shown. Reason: Frameshift at position 237.
    The sequence BAB15788.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti91 – 911T → N in AAG16633. 1 PublicationCurated
    Sequence conflicti116 – 1161S → F in AAG16633. 1 PublicationCurated
    Sequence conflicti149 – 1491A → R in AAL55747. (PubMed:15498874)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MRGGRARPAWESFMGLPPRS SAKWGAGQSLDRLCCAPGSR GLAGAPGRMRAPPAGRSQPA GGPGDSLPHPPGGLGPGGSA WARRAEAAASRARGGGRGGP GITWAEAGPGAPGGLSPESG RRQRERWRLPAFPPSRAWAP SRTGERQPGERAHLRLSARP ALPGAGLLSAPLSARNPGLV RGPAPWSLASAGAPPRAALS PAGALLLQPPARRVLCPRSE GGSRTGRAGPSGWAPPRGAR SAESTDRLKGM in isoform 5. CuratedVSP_047113
    Alternative sequencei154 – 22471SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2. 1 PublicationVSP_014058Add
    BLAST
    Alternative sequencei225 – 352128Missing in isoform 2. 1 PublicationVSP_014059Add
    BLAST
    Alternative sequencei256 – 35297GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4. 1 PublicationVSP_014060Add
    BLAST
    Alternative sequencei328 – 35225VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3. 3 PublicationsVSP_014061Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY007729 mRNA. Translation: AAG16633.1. Frameshift.
    AY070438 mRNA. Translation: AAL65265.1. Frameshift.
    AY217349 mRNA. Translation: AAO45102.1.
    AF289563 mRNA. Translation: AAL55747.1. Frameshift.
    AK024498 mRNA. Translation: BAB15788.1. Different initiation.
    AK027800 mRNA. Translation: BAB55378.1.
    AC037459 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63667.1.
    CH471080 Genomic DNA. Translation: EAW63669.1.
    BC021556 mRNA. Translation: AAH21556.1.
    BC071774 mRNA. Translation: AAH71774.1.
    CCDSiCCDS34860.1. [Q96JY6-3]
    CCDS34861.1. [Q96JY6-4]
    CCDS6032.2. [Q96JY6-5]
    RefSeqiNP_067643.3. NM_021630.5. [Q96JY6-5]
    NP_789847.1. NM_176871.3. [Q96JY6-3]
    NP_932159.1. NM_198042.3. [Q96JY6-4]
    UniGeneiHs.632034.

    Genome annotation databases

    EnsembliENST00000265810; ENSP00000265810; ENSG00000120913. [Q96JY6-3]
    ENST00000308354; ENSP00000312634; ENSG00000120913. [Q96JY6-5]
    ENST00000339162; ENSP00000342035; ENSG00000120913. [Q96JY6-4]
    ENST00000397760; ENSP00000380867; ENSG00000120913. [Q96JY6-1]
    ENST00000397761; ENSP00000380868; ENSG00000120913. [Q96JY6-1]
    ENST00000409141; ENSP00000386868; ENSG00000120913. [Q96JY6-4]
    ENST00000409417; ENSP00000387084; ENSG00000120913. [Q96JY6-1]
    GeneIDi64236.
    KEGGihsa:64236.
    UCSCiuc003xca.3. human. [Q96JY6-4]
    uc003xcc.2. human. [Q96JY6-3]

    Polymorphism databases

    DMDMi67461069.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY007729 mRNA. Translation: AAG16633.1 . Frameshift.
    AY070438 mRNA. Translation: AAL65265.1 . Frameshift.
    AY217349 mRNA. Translation: AAO45102.1 .
    AF289563 mRNA. Translation: AAL55747.1 . Frameshift.
    AK024498 mRNA. Translation: BAB15788.1 . Different initiation.
    AK027800 mRNA. Translation: BAB55378.1 .
    AC037459 Genomic DNA. No translation available.
    CH471080 Genomic DNA. Translation: EAW63667.1 .
    CH471080 Genomic DNA. Translation: EAW63669.1 .
    BC021556 mRNA. Translation: AAH21556.1 .
    BC071774 mRNA. Translation: AAH71774.1 .
    CCDSi CCDS34860.1. [Q96JY6-3 ]
    CCDS34861.1. [Q96JY6-4 ]
    CCDS6032.2. [Q96JY6-5 ]
    RefSeqi NP_067643.3. NM_021630.5. [Q96JY6-5 ]
    NP_789847.1. NM_176871.3. [Q96JY6-3 ]
    NP_932159.1. NM_198042.3. [Q96JY6-4 ]
    UniGenei Hs.632034.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2PA1 X-ray 1.70 A 1-82 [» ]
    3PDV X-ray 2.20 A 1-83 [» ]
    ProteinModelPortali Q96JY6.
    SMRi Q96JY6. Positions 1-82, 282-347.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122122. 4 interactions.
    STRINGi 9606.ENSP00000265810.

    PTM databases

    PhosphoSitei Q96JY6.

    Polymorphism databases

    DMDMi 67461069.

    Proteomic databases

    MaxQBi Q96JY6.
    PaxDbi Q96JY6.
    PRIDEi Q96JY6.

    Protocols and materials databases

    DNASUi 64236.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000265810 ; ENSP00000265810 ; ENSG00000120913 . [Q96JY6-3 ]
    ENST00000308354 ; ENSP00000312634 ; ENSG00000120913 . [Q96JY6-5 ]
    ENST00000339162 ; ENSP00000342035 ; ENSG00000120913 . [Q96JY6-4 ]
    ENST00000397760 ; ENSP00000380867 ; ENSG00000120913 . [Q96JY6-1 ]
    ENST00000397761 ; ENSP00000380868 ; ENSG00000120913 . [Q96JY6-1 ]
    ENST00000409141 ; ENSP00000386868 ; ENSG00000120913 . [Q96JY6-4 ]
    ENST00000409417 ; ENSP00000387084 ; ENSG00000120913 . [Q96JY6-1 ]
    GeneIDi 64236.
    KEGGi hsa:64236.
    UCSCi uc003xca.3. human. [Q96JY6-4 ]
    uc003xcc.2. human. [Q96JY6-3 ]

    Organism-specific databases

    CTDi 64236.
    GeneCardsi GC08P022435.
    HGNCi HGNC:13992. PDLIM2.
    HPAi HPA003880.
    MIMi 609722. gene.
    neXtProti NX_Q96JY6.
    PharmGKBi PA33159.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG246155.
    HOGENOMi HOG000290704.
    HOVERGENi HBG061371.
    OMAi FQSLAHS.
    OrthoDBi EOG77DJ69.
    PhylomeDBi Q96JY6.
    TreeFami TF106408.

    Miscellaneous databases

    EvolutionaryTracei Q96JY6.
    GeneWikii PDLIM2.
    GenomeRNAii 64236.
    NextBioi 35534917.
    PROi Q96JY6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96JY6.
    Bgeei Q96JY6.
    CleanExi HS_PDLIM2.
    Genevestigatori Q96JY6.

    Family and domain databases

    Gene3Di 2.10.110.10. 1 hit.
    2.30.42.10. 1 hit.
    InterProi IPR001478. PDZ.
    IPR001781. Znf_LIM.
    [Graphical view ]
    Pfami PF00412. LIM. 1 hit.
    PF00595. PDZ. 1 hit.
    [Graphical view ]
    SMARTi SM00132. LIM. 1 hit.
    SM00228. PDZ. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50156. SSF50156. 1 hit.
    PROSITEi PS00478. LIM_DOMAIN_1. 1 hit.
    PS50023. LIM_DOMAIN_2. 1 hit.
    PS50106. PDZ. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Mystique, a PDZ-LIM protein with one carboxyl terminal LIM domain."
      Lau Y.M., Kotaka M., Chan A.H., Lee S.M.Y., Au C.C., Chim S.S.C., Kok L.D.S., Ng E.K.O., Siu S.S., Yiu S.W.H., Fung K.P., Waye M.M.Y., Tsui S.K.W., Lee C.Y.
      Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    2. Guo J.H., Zan Q., Yu L.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Hypothalamus.
    3. "Cloning a novel protein containing PDZ and LIM domains."
      Shan Y.X., Yu L., Huang C.Q.
      Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Characterization of long cDNA clones from human adult spleen."
      Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
      DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Spleen.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Placenta and Spleen.
    7. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Placenta.
    10. "Mystique is a new IGF-I regulated PDZ-LIM domain protein that promotes cell attachment and migration and suppresses anchorage independent growth."
      Loughran G., Healy N., Kiely P.A., Huigsloot M., Kedersha N.L., O'connor R.
      Mol. Biol. Cell 16:1811-1822(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-80; CYS-313 AND CYS-316.
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Structure of the PDZ domain of human PDLIM2 bound to a C-terminal extension from human beta-tropomyosin."
      Structural genomics consortium (SGC)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 1-82.

    Entry informationi

    Entry nameiPDLI2_HUMAN
    AccessioniPrimary (citable) accession number: Q96JY6
    Secondary accession number(s): D3DSR5
    , J3KNH4, Q7Z584, Q86WM8, Q8WZ29, Q9H4L9, Q9H7I2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3