Q96JY6 (PDLI2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PDZ and LIM domain protein 2 Alternative name(s): PDZ-LIM protein mystique | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 352 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity. Ref.9 |
| Subunit structure | Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9 By similarity. |
| Subcellular location | Cytoplasm. Nucleus Ref.9. Note: May be partially nuclear. Ref.9 Isoform 1: Cytoplasm › cytoskeleton Ref.9. Note: Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin (PXN). Ref.9 Isoform 2: Cytoplasm › cytoskeleton Ref.9. |
| Sequence similarities | Contains 1 LIM zinc-binding domain. Contains 1 PDZ (DHR) domain. |
| Sequence caution | The sequence AAG16633.1 differs from that shown. Reason: Frameshift at position 131. The sequence AAL55747.1 differs from that shown. Reason: Frameshift at positions 42 and 207. The sequence AAL65265.1 differs from that shown. Reason: Frameshift at position 237. The sequence BAB15788.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | LIM domain |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | actin cytoskeleton Inferred from direct assay. Source: HPA cell surfaceInferred from direct assay PubMed 12493773. Source: UniProtKB cytoplasmInferred from electronic annotation. Source: UniProtKB-SubCell focal adhesionInferred from direct assay. Source: HPA nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | zinc ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96JY6-1) Also known as: Mystique 2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96JY6-2) The sequence of this isoform differs from the canonical sequence as follows: 154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG 225-352: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96JY6-3) Also known as: Mystique 1; The sequence of this isoform differs from the canonical sequence as follows: 328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW | ||||||
| Isoform 4 (identifier: Q96JY6-4) Also known as: Mystique 3; The sequence of this isoform differs from the canonical sequence as follows: 256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 352 | 352 | PDZ and LIM domain protein 2 | PRO_0000075862 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 1 – 84 | 84 | PDZ | |||||||||||||||||||||||||
| Domain | 284 – 344 | 61 | LIM zinc-binding | |||||||||||||||||||||||||
| Compositional bias | 114 – 161 | 48 | Ser-rich | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 197 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 154 – 224 | 71 | SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2. | VSP_014058 | ||||||||||||||||||||||||
| Alternative sequence | 225 – 352 | 128 | Missing in isoform 2. | VSP_014059 | ||||||||||||||||||||||||
| Alternative sequence | 256 – 352 | 97 | GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4. | VSP_014060 | ||||||||||||||||||||||||
| Alternative sequence | 328 – 352 | 25 | VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3. | VSP_014061 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Mutagenesis | 80 | 1 | L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. Ref.9 | |||||||||||||||||||||||||
| Mutagenesis | 313 | 1 | C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. Ref.9 | |||||||||||||||||||||||||
| Mutagenesis | 316 | 1 | C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. Ref.9 | |||||||||||||||||||||||||
| Sequence conflict | 91 | 1 | T → N in AAG16633. Ref.1 | |||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | S → F in AAG16633. Ref.1 | |||||||||||||||||||||||||
| Sequence conflict | 149 | 1 | A → R Ref.3 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Beta strand | 1 – 7 | 7 | ||||||||||||||||||||||||||
| Beta strand | 9 – 11 | 3 | ||||||||||||||||||||||||||
| Beta strand | 14 – 20 | 7 | ||||||||||||||||||||||||||
| Helix | 21 – 23 | 3 | ||||||||||||||||||||||||||
| Beta strand | 25 – 32 | 8 | ||||||||||||||||||||||||||
| Beta strand | 34 – 36 | 3 | ||||||||||||||||||||||||||
| Helix | 37 – 40 | 4 | ||||||||||||||||||||||||||
| Beta strand | 48 – 52 | 5 | ||||||||||||||||||||||||||
| Beta strand | 55 – 57 | 3 | ||||||||||||||||||||||||||
| Helix | 62 – 70 | 9 | ||||||||||||||||||||||||||
| Beta strand | 74 – 82 | 9 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mystique, a PDZ-LIM protein with one carboxyl terminal LIM domain." Lau Y.M., Kotaka M., Chan A.H., Lee S.M.Y., Au C.C., Chim S.S.C., Kok L.D.S., Ng E.K.O., Siu S.S., Yiu S.W.H., Fung K.P., Waye M.M.Y., Tsui S.K.W., Lee C.Y. Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [2] | Guo J.H., Zan Q., Yu L. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Hypothalamus. |
| [3] | "Cloning a novel protein containing PDZ and LIM domains." Shan Y.X., Yu L., Huang C.Q. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [4] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Characterization of long cDNA clones from human adult spleen." Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O. DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Spleen. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta and Spleen. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Placenta. |
| [9] | "Mystique is a new IGF-I regulated PDZ-LIM domain protein that promotes cell attachment and migration and suppresses anchorage independent growth." Loughran G., Healy N., Kiely P.A., Huigsloot M., Kedersha N.L., O'connor R. Mol. Biol. Cell 16:1811-1822(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-80; CYS-313 AND CYS-316. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [11] | "Structure of the PDZ domain of human PDLIM2 bound to a C-terminal extension from human beta-tropomyosin." Structural genomics consortium (SGC) Submitted (FEB-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 1-82. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY007729 mRNA. Translation: AAG16633.1. Frameshift. AY070438 mRNA. Translation: AAL65265.1. Frameshift. AY217349 mRNA. Translation: AAO45102.1. AF289563 mRNA. Translation: AAL55747.1. Frameshift. AK024498 mRNA. Translation: BAB15788.1. Different initiation. AK027800 mRNA. Translation: BAB55378.1. CH471080 Genomic DNA. Translation: EAW63667.1. CH471080 Genomic DNA. Translation: EAW63669.1. BC021556 mRNA. Translation: AAH21556.1. BC071774 mRNA. Translation: AAH71774.1. | ||||||||||||||||||
| IPI | IPI00007983. IPI00383278. IPI00386717. IPI00396593. | ||||||||||||||||||
| RefSeq | NP_067643.3. NM_021630.5. NP_789847.1. NM_176871.3. NP_932159.1. NM_198042.3. | ||||||||||||||||||
| UniGene | Hs.632034. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q96JY6. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| STRING | 9606.ENSP00000265810. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q96JY6. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q96JY6. | ||||||||||||||||||
| PRIDE | Q96JY6. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 64236. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000265810; ENSP00000265810; ENSG00000120913. ENST00000339162; ENSP00000342035; ENSG00000120913. ENST00000397760; ENSP00000380867; ENSG00000120913. ENST00000397761; ENSP00000380868; ENSG00000120913. ENST00000409141; ENSP00000386868; ENSG00000120913. ENST00000409417; ENSP00000387084; ENSG00000120913. | ||||||||||||||||||
| GeneID | 64236. | ||||||||||||||||||
| KEGG | hsa:64236. | ||||||||||||||||||
| UCSC | uc003xby.3. human. uc003xca.3. human. uc003xcc.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 64236. | ||||||||||||||||||
| GeneCards | GC08P022435. | ||||||||||||||||||
| HGNC | HGNC:13992. PDLIM2. | ||||||||||||||||||
| HPA | HPA003880. | ||||||||||||||||||
| MIM | 609722. gene. | ||||||||||||||||||
| neXtProt | NX_Q96JY6. | ||||||||||||||||||
| PharmGKB | PA33159. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG246155. | ||||||||||||||||||
| HOGENOM | HOG000290704. | ||||||||||||||||||
| HOVERGEN | HBG061371. | ||||||||||||||||||
| OMA | FQSLAHS. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q96JY6. | ||||||||||||||||||
| Bgee | Q96JY6. | ||||||||||||||||||
| CleanEx | HS_PDLIM2. | ||||||||||||||||||
| Genevestigator | Q96JY6. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 2.10.110.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR001478. PDZ. IPR001781. Znf_LIM. [Graphical view] | ||||||||||||||||||
| Pfam | PF00412. LIM. 1 hit. PF00595. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00132. LIM. 1 hit. SM00228. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50156. PDZ. 1 hit. | ||||||||||||||||||
| PROSITE | PS00478. LIM_DOMAIN_1. 1 hit. PS50023. LIM_DOMAIN_2. 1 hit. PS50106. PDZ. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q96JY6. | ||||||||||||||||||
| GenomeRNAi | 64236. | ||||||||||||||||||
| NextBio | 66179. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PDLI2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96JY6 Secondary accession number(s): D3DSR5 Q9H7I2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
