Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ and LIM domain protein 2

Gene

PDLIM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.1 Publication

GO - Molecular functioni

Keywordsi

LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ and LIM domain protein 2
Alternative name(s):
PDZ-LIM protein mystique
Gene namesi
Name:PDLIM2
ORF Names:PP6345
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

EuPathDBiHostDB:ENSG00000120913.23
HGNCiHGNC:13992 PDLIM2
MIMi609722 gene
neXtProtiNX_Q96JY6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi80L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. 1 Publication1
Mutagenesisi313C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. 1 Publication1
Mutagenesisi316C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. 1 Publication1

Organism-specific databases

DisGeNETi64236
OpenTargetsiENSG00000120913
PharmGKBiPA33159

Polymorphism and mutation databases

BioMutaiPDLIM2
DMDMi67461069

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758621 – 352PDZ and LIM domain protein 2Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei124PhosphoserineCombined sources1
Modified residuei126PhosphothreonineCombined sources1
Modified residuei127PhosphoserineBy similarity1
Modified residuei129PhosphoserineCombined sources1
Modified residuei134PhosphoserineBy similarity1
Modified residuei137PhosphoserineCombined sources1
Modified residuei143PhosphoserineBy similarity1
Modified residuei161PhosphoserineCombined sources1
Modified residuei197PhosphoserineCombined sources1
Modified residuei203PhosphoserineBy similarity1
Modified residuei213PhosphoserineBy similarity1
Modified residuei266PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96JY6
MaxQBiQ96JY6
PaxDbiQ96JY6
PeptideAtlasiQ96JY6
PRIDEiQ96JY6

PTM databases

iPTMnetiQ96JY6
PhosphoSitePlusiQ96JY6

Expressioni

Gene expression databases

BgeeiENSG00000120913
CleanExiHS_PDLIM2
ExpressionAtlasiQ96JY6 baseline and differential
GenevisibleiQ96JY6 HS

Organism-specific databases

HPAiHPA003880

Interactioni

Subunit structurei

Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-9057264,EBI-717666

Protein-protein interaction databases

BioGridi122122, 14 interactors
IntActiQ96JY6, 11 interactors
MINTiQ96JY6
STRINGi9606.ENSP00000312634

Structurei

Secondary structure

1352
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi1 – 7Combined sources7
Beta strandi9 – 11Combined sources3
Beta strandi14 – 20Combined sources7
Helixi21 – 23Combined sources3
Beta strandi25 – 32Combined sources8
Beta strandi34 – 36Combined sources3
Helixi37 – 40Combined sources4
Beta strandi48 – 52Combined sources5
Beta strandi55 – 57Combined sources3
Helixi62 – 70Combined sources9
Beta strandi74 – 82Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2PA1X-ray1.70A1-82[»]
3PDVX-ray2.20A1-83[»]
ProteinModelPortaliQ96JY6
SMRiQ96JY6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96JY6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 84PDZPROSITE-ProRule annotationAdd BLAST84
Domaini284 – 344LIM zinc-bindingPROSITE-ProRule annotationAdd BLAST61

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi114 – 161Ser-richAdd BLAST48

Keywords - Domaini

LIM domain

Phylogenomic databases

eggNOGiKOG1703 Eukaryota
ENOG410XRD4 LUCA
GeneTreeiENSGT00590000082980
HOGENOMiHOG000290704
HOVERGENiHBG061371
InParanoidiQ96JY6
OMAiFQSLAHS
OrthoDBiEOG091G0A6C
PhylomeDBiQ96JY6
TreeFamiTF106408

Family and domain databases

InterProiView protein in InterPro
IPR031847 DUF4749
IPR001478 PDZ
IPR036034 PDZ_sf
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF15936 DUF4749, 1 hit
PF00412 LIM, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 1 hit
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 1 hit
PS50023 LIM_DOMAIN_2, 1 hit
PS50106 PDZ, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96JY6-1) [UniParc]FASTAAdd to basket
Also known as: Mystique 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALTVDVAGP APWGFRITGG RDFHTPIMVT KVAERGKAKD ADLRPGDIIV
60 70 80 90 100
AINGESAEGM LHAEAQSKIR QSPSPLRLQL DRSQATSPGQ TNGDSSLEVL
110 120 130 140 150
ATRFQGSVRT YTESQSSLRS SYSSPTSLSP RAGSPFSPPP SSSSLTGEAA
160 170 180 190 200
ISRSFQSLAC SPGLPAADRL SYSGRPGSRQ AGLGRAGDSA VLVLPPSPGP
210 220 230 240 250
RSSRPSMDSE GGSLLLDEDS EVFKMLQENR EGRAAPRQSS SFRLLQEALE
260 270 280 290 300
AEERGGTPAF LPSSLSPQSS LPASRALATP PKLHTCEKCS TSIANQAVRI
310 320 330 340 350
QEGRYRHPGC YTCADCGLNL KMRGHFWVGD ELYCEKHARQ RYSAPATLSS

RA
Length:352
Mass (Da):37,459
Last modified:December 1, 2001 - v1
Checksum:iE36EC66C61C5E9DB
GO
Isoform 2 (identifier: Q96JY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG
     225-352: Missing.

Note: No experimental confirmation available.
Show »
Length:224
Mass (Da):23,073
Checksum:iF4C39E4F01144F52
GO
Isoform 3 (identifier: Q96JY6-3) [UniParc]FASTAAdd to basket
Also known as: Mystique 1

The sequence of this isoform differs from the canonical sequence as follows:
     328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW

Show »
Length:366
Mass (Da):39,181
Checksum:i739E0BB65889B1F6
GO
Isoform 4 (identifier: Q96JY6-4) [UniParc]FASTAAdd to basket
Also known as: Mystique 3

The sequence of this isoform differs from the canonical sequence as follows:
     256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG

Show »
Length:278
Mass (Da):29,105
Checksum:iF3D480E6DEAD66E9
GO
Isoform 5 (identifier: Q96JY6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGGRARPAW...AESTDRLKGM

Show »
Length:602
Mass (Da):62,746
Checksum:iFCA292BEEBB24930
GO

Sequence cautioni

The sequence AAG16633 differs from that shown. Reason: Frameshift at position 131.Curated
The sequence AAL55747 differs from that shown. Reason: Frameshift at positions 42 and 207.Curated
The sequence AAL65265 differs from that shown. Reason: Frameshift at position 237.Curated
The sequence BAB15788 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti91T → N in AAG16633 (Ref. 1) Curated1
Sequence conflicti116S → F in AAG16633 (Ref. 1) Curated1
Sequence conflicti149A → R in AAL55747 (PubMed:15498874).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471131M → MRGGRARPAWESFMGLPPRS SAKWGAGQSLDRLCCAPGSR GLAGAPGRMRAPPAGRSQPA GGPGDSLPHPPGGLGPGGSA WARRAEAAASRARGGGRGGP GITWAEAGPGAPGGLSPESG RRQRERWRLPAFPPSRAWAP SRTGERQPGERAHLRLSARP ALPGAGLLSAPLSARNPGLV RGPAPWSLASAGAPPRAALS PAGALLLQPPARRVLCPRSE GGSRTGRAGPSGWAPPRGAR SAESTDRLKGM in isoform 5. Curated1
Alternative sequenceiVSP_014058154 – 224SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2. 1 PublicationAdd BLAST71
Alternative sequenceiVSP_014059225 – 352Missing in isoform 2. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_014060256 – 352GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_014061328 – 352VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3. 3 PublicationsAdd BLAST25

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY007729 mRNA Translation: AAG16633.1 Frameshift.
AY070438 mRNA Translation: AAL65265.1 Frameshift.
AY217349 mRNA Translation: AAO45102.1
AF289563 mRNA Translation: AAL55747.1 Frameshift.
AK024498 mRNA Translation: BAB15788.1 Different initiation.
AK027800 mRNA Translation: BAB55378.1
AC037459 Genomic DNA No translation available.
CH471080 Genomic DNA Translation: EAW63667.1
CH471080 Genomic DNA Translation: EAW63669.1
BC021556 mRNA Translation: AAH21556.1
BC071774 mRNA Translation: AAH71774.1
CCDSiCCDS34860.1 [Q96JY6-3]
CCDS34861.1 [Q96JY6-4]
CCDS6032.2 [Q96JY6-5]
RefSeqiNP_067643.3, NM_021630.5 [Q96JY6-5]
NP_789847.1, NM_176871.3 [Q96JY6-3]
NP_932159.1, NM_198042.3 [Q96JY6-4]
UniGeneiHs.632034

Genome annotation databases

EnsembliENST00000265810; ENSP00000265810; ENSG00000120913 [Q96JY6-3]
ENST00000308354; ENSP00000312634; ENSG00000120913 [Q96JY6-5]
ENST00000339162; ENSP00000342035; ENSG00000120913 [Q96JY6-5]
ENST00000397760; ENSP00000380867; ENSG00000120913 [Q96JY6-1]
ENST00000397761; ENSP00000380868; ENSG00000120913 [Q96JY6-1]
ENST00000409141; ENSP00000386868; ENSG00000120913 [Q96JY6-4]
ENST00000409417; ENSP00000387084; ENSG00000120913 [Q96JY6-1]
GeneIDi64236
KEGGihsa:64236
UCSCiuc003xby.5 human [Q96JY6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPDLI2_HUMAN
AccessioniPrimary (citable) accession number: Q96JY6
Secondary accession number(s): D3DSR5
, J3KNH4, Q7Z584, Q86WM8, Q8WZ29, Q9H4L9, Q9H7I2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: December 1, 2001
Last modified: April 25, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health