SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JY6

- PDLI2_HUMAN

UniProt

Q96JY6 - PDLI2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

PDZ and LIM domain protein 2

Gene
PDLIM2, PP6345
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Probable adapter protein located at the actin cytoskeleton that promotes cell attachment. Necessary for the migratory capacity of epithelial cells. Overexpression enhances cell adhesion to collagen and fibronectin and suppresses anchorage independent growth. May contribute to tumor cell migratory capacity.1 Publication

GO - Molecular functioni

  1. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ and LIM domain protein 2
Alternative name(s):
PDZ-LIM protein mystique
Gene namesi
Name:PDLIM2
ORF Names:PP6345
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:13992. PDLIM2.

Subcellular locationi

Cytoplasm. Nucleus
Note: May be partially nuclear.1 Publication
Isoform 1 : Cytoplasmcytoskeleton
Note: Colocalizes with beta-1 integrin (ITGB1) and alpha-actinin but not with paxillin (PXN).1 Publication
Isoform 2 : Cytoplasmcytoskeleton 1 Publication
Isoform 3 : Nucleus 1 Publication

GO - Cellular componenti

  1. actin cytoskeleton Source: HPA
  2. cytoplasm Source: UniProtKB-SubCell
  3. extracellular vesicular exosome Source: UniProt
  4. focal adhesion Source: HPA
  5. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi80 – 801L → K: Abolishes cell adhesion to collagen and ability to suppress anchorage independent growth. 1 Publication
Mutagenesisi313 – 3131C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-316. 1 Publication
Mutagenesisi316 – 3161C → S: Abolishes ability to suppress anchorage independent growth but not cell adhesion to collagen; when associated with S-313. 1 Publication

Organism-specific databases

PharmGKBiPA33159.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 352352PDZ and LIM domain protein 2PRO_0000075862Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei197 – 1971Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96JY6.
PaxDbiQ96JY6.
PRIDEiQ96JY6.

PTM databases

PhosphoSiteiQ96JY6.

Expressioni

Gene expression databases

ArrayExpressiQ96JY6.
BgeeiQ96JY6.
CleanExiHS_PDLIM2.
GenevestigatoriQ96JY6.

Organism-specific databases

HPAiHPA003880.

Interactioni

Subunit structurei

Interacts with alpha-actinins ACTN1 and ACTN4, FLNA and MYH9 By similarity.

Protein-protein interaction databases

BioGridi122122. 4 interactions.
STRINGi9606.ENSP00000265810.

Structurei

Secondary structure

352
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1 – 77
Beta strandi9 – 113
Beta strandi14 – 207
Helixi21 – 233
Beta strandi25 – 328
Beta strandi34 – 363
Helixi37 – 404
Beta strandi48 – 525
Beta strandi55 – 573
Helixi62 – 709
Beta strandi74 – 829

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2PA1X-ray1.70A1-82[»]
3PDVX-ray2.20A1-83[»]
ProteinModelPortaliQ96JY6.
SMRiQ96JY6. Positions 1-82, 282-347.

Miscellaneous databases

EvolutionaryTraceiQ96JY6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 8484PDZAdd
BLAST
Domaini284 – 34461LIM zinc-bindingAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi114 – 16148Ser-richAdd
BLAST

Sequence similaritiesi

Contains 1 PDZ (DHR) domain.

Keywords - Domaini

LIM domain

Phylogenomic databases

eggNOGiNOG246155.
HOGENOMiHOG000290704.
HOVERGENiHBG061371.
OMAiFQSLAHS.
OrthoDBiEOG77DJ69.
PhylomeDBiQ96JY6.
TreeFamiTF106408.

Family and domain databases

Gene3Di2.10.110.10. 1 hit.
2.30.42.10. 1 hit.
InterProiIPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF00412. LIM. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 1 hit.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JY6-1) [UniParc]FASTAAdd to Basket

Also known as: Mystique 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MALTVDVAGP APWGFRITGG RDFHTPIMVT KVAERGKAKD ADLRPGDIIV    50
AINGESAEGM LHAEAQSKIR QSPSPLRLQL DRSQATSPGQ TNGDSSLEVL 100
ATRFQGSVRT YTESQSSLRS SYSSPTSLSP RAGSPFSPPP SSSSLTGEAA 150
ISRSFQSLAC SPGLPAADRL SYSGRPGSRQ AGLGRAGDSA VLVLPPSPGP 200
RSSRPSMDSE GGSLLLDEDS EVFKMLQENR EGRAAPRQSS SFRLLQEALE 250
AEERGGTPAF LPSSLSPQSS LPASRALATP PKLHTCEKCS TSIANQAVRI 300
QEGRYRHPGC YTCADCGLNL KMRGHFWVGD ELYCEKHARQ RYSAPATLSS 350
RA 352
Length:352
Mass (Da):37,459
Last modified:December 1, 2001 - v1
Checksum:iE36EC66C61C5E9DB
GO
Isoform 2 (identifier: Q96JY6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-224: SFQSLACSPG...LLDEDSEVFK → RRPRPRWRLG...LSALAGSPGG
     225-352: Missing.

Note: No experimental confirmation available.

Show »
Length:224
Mass (Da):23,073
Checksum:iF4C39E4F01144F52
GO
Isoform 3 (identifier: Q96JY6-3) [UniParc]FASTAAdd to Basket

Also known as: Mystique 1

The sequence of this isoform differs from the canonical sequence as follows:
     328-352: VGDELYCEKHARQRYSAPATLSSRA → EDACAMEGMRLSLEALEGMVEGAKRRDRRKTRRPIQPSW

Show »
Length:366
Mass (Da):39,181
Checksum:i739E0BB65889B1F6
GO
Isoform 4 (identifier: Q96JY6-4) [UniParc]FASTAAdd to Basket

Also known as: Mystique 3

The sequence of this isoform differs from the canonical sequence as follows:
     256-352: GTPAFLPSSL...SAPATLSSRA → TRLCASRRAGTATPAATPVPTVG

Show »
Length:278
Mass (Da):29,105
Checksum:iF3D480E6DEAD66E9
GO
Isoform 5 (identifier: Q96JY6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRGGRARPAW...AESTDRLKGM

Show »
Length:602
Mass (Da):62,746
Checksum:iFCA292BEEBB24930
GO

Sequence cautioni

The sequence AAG16633.1 differs from that shown. Reason: Frameshift at position 131.
The sequence AAL55747.1 differs from that shown. Reason: Frameshift at positions 42 and 207.
The sequence AAL65265.1 differs from that shown. Reason: Frameshift at position 237.
The sequence BAB15788.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MRGGRARPAWESFMGLPPRS SAKWGAGQSLDRLCCAPGSR GLAGAPGRMRAPPAGRSQPA GGPGDSLPHPPGGLGPGGSA WARRAEAAASRARGGGRGGP GITWAEAGPGAPGGLSPESG RRQRERWRLPAFPPSRAWAP SRTGERQPGERAHLRLSARP ALPGAGLLSAPLSARNPGLV RGPAPWSLASAGAPPRAALS PAGALLLQPPARRVLCPRSE GGSRTGRAGPSGWAPPRGAR SAESTDRLKGM in isoform 5. VSP_047113
Alternative sequencei154 – 22471SFQSL…SEVFK → RRPRPRWRLGGAGAAAFPGP SFLQAQHGLGRGKPPPGRGL GSLQDAAGKSRGTGGPPTVQ LLSALAGSPGG in isoform 2. VSP_014058Add
BLAST
Alternative sequencei225 – 352128Missing in isoform 2. VSP_014059Add
BLAST
Alternative sequencei256 – 35297GTPAF…LSSRA → TRLCASRRAGTATPAATPVP TVG in isoform 4. VSP_014060Add
BLAST
Alternative sequencei328 – 35225VGDEL…LSSRA → EDACAMEGMRLSLEALEGMV EGAKRRDRRKTRRPIQPSW in isoform 3. VSP_014061Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti91 – 911T → N in AAG16633. 1 Publication
Sequence conflicti116 – 1161S → F in AAG16633. 1 Publication
Sequence conflicti149 – 1491A → R in AAL55747. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY007729 mRNA. Translation: AAG16633.1. Frameshift.
AY070438 mRNA. Translation: AAL65265.1. Frameshift.
AY217349 mRNA. Translation: AAO45102.1.
AF289563 mRNA. Translation: AAL55747.1. Frameshift.
AK024498 mRNA. Translation: BAB15788.1. Different initiation.
AK027800 mRNA. Translation: BAB55378.1.
AC037459 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63667.1.
CH471080 Genomic DNA. Translation: EAW63669.1.
BC021556 mRNA. Translation: AAH21556.1.
BC071774 mRNA. Translation: AAH71774.1.
CCDSiCCDS34860.1. [Q96JY6-3]
CCDS34861.1. [Q96JY6-4]
CCDS6032.2. [Q96JY6-5]
RefSeqiNP_067643.3. NM_021630.5. [Q96JY6-5]
NP_789847.1. NM_176871.3. [Q96JY6-3]
NP_932159.1. NM_198042.3. [Q96JY6-4]
UniGeneiHs.632034.

Genome annotation databases

EnsembliENST00000265810; ENSP00000265810; ENSG00000120913. [Q96JY6-3]
ENST00000308354; ENSP00000312634; ENSG00000120913. [Q96JY6-5]
ENST00000339162; ENSP00000342035; ENSG00000120913. [Q96JY6-4]
ENST00000397760; ENSP00000380867; ENSG00000120913. [Q96JY6-1]
ENST00000397761; ENSP00000380868; ENSG00000120913. [Q96JY6-1]
ENST00000409141; ENSP00000386868; ENSG00000120913. [Q96JY6-4]
ENST00000409417; ENSP00000387084; ENSG00000120913. [Q96JY6-1]
GeneIDi64236.
KEGGihsa:64236.
UCSCiuc003xca.3. human. [Q96JY6-4]
uc003xcc.2. human. [Q96JY6-3]

Polymorphism databases

DMDMi67461069.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY007729 mRNA. Translation: AAG16633.1 . Frameshift.
AY070438 mRNA. Translation: AAL65265.1 . Frameshift.
AY217349 mRNA. Translation: AAO45102.1 .
AF289563 mRNA. Translation: AAL55747.1 . Frameshift.
AK024498 mRNA. Translation: BAB15788.1 . Different initiation.
AK027800 mRNA. Translation: BAB55378.1 .
AC037459 Genomic DNA. No translation available.
CH471080 Genomic DNA. Translation: EAW63667.1 .
CH471080 Genomic DNA. Translation: EAW63669.1 .
BC021556 mRNA. Translation: AAH21556.1 .
BC071774 mRNA. Translation: AAH71774.1 .
CCDSi CCDS34860.1. [Q96JY6-3 ]
CCDS34861.1. [Q96JY6-4 ]
CCDS6032.2. [Q96JY6-5 ]
RefSeqi NP_067643.3. NM_021630.5. [Q96JY6-5 ]
NP_789847.1. NM_176871.3. [Q96JY6-3 ]
NP_932159.1. NM_198042.3. [Q96JY6-4 ]
UniGenei Hs.632034.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2PA1 X-ray 1.70 A 1-82 [» ]
3PDV X-ray 2.20 A 1-83 [» ]
ProteinModelPortali Q96JY6.
SMRi Q96JY6. Positions 1-82, 282-347.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122122. 4 interactions.
STRINGi 9606.ENSP00000265810.

PTM databases

PhosphoSitei Q96JY6.

Polymorphism databases

DMDMi 67461069.

Proteomic databases

MaxQBi Q96JY6.
PaxDbi Q96JY6.
PRIDEi Q96JY6.

Protocols and materials databases

DNASUi 64236.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000265810 ; ENSP00000265810 ; ENSG00000120913 . [Q96JY6-3 ]
ENST00000308354 ; ENSP00000312634 ; ENSG00000120913 . [Q96JY6-5 ]
ENST00000339162 ; ENSP00000342035 ; ENSG00000120913 . [Q96JY6-4 ]
ENST00000397760 ; ENSP00000380867 ; ENSG00000120913 . [Q96JY6-1 ]
ENST00000397761 ; ENSP00000380868 ; ENSG00000120913 . [Q96JY6-1 ]
ENST00000409141 ; ENSP00000386868 ; ENSG00000120913 . [Q96JY6-4 ]
ENST00000409417 ; ENSP00000387084 ; ENSG00000120913 . [Q96JY6-1 ]
GeneIDi 64236.
KEGGi hsa:64236.
UCSCi uc003xca.3. human. [Q96JY6-4 ]
uc003xcc.2. human. [Q96JY6-3 ]

Organism-specific databases

CTDi 64236.
GeneCardsi GC08P022435.
HGNCi HGNC:13992. PDLIM2.
HPAi HPA003880.
MIMi 609722. gene.
neXtProti NX_Q96JY6.
PharmGKBi PA33159.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG246155.
HOGENOMi HOG000290704.
HOVERGENi HBG061371.
OMAi FQSLAHS.
OrthoDBi EOG77DJ69.
PhylomeDBi Q96JY6.
TreeFami TF106408.

Miscellaneous databases

EvolutionaryTracei Q96JY6.
GeneWikii PDLIM2.
GenomeRNAii 64236.
NextBioi 35534917.
PROi Q96JY6.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96JY6.
Bgeei Q96JY6.
CleanExi HS_PDLIM2.
Genevestigatori Q96JY6.

Family and domain databases

Gene3Di 2.10.110.10. 1 hit.
2.30.42.10. 1 hit.
InterProi IPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view ]
Pfami PF00412. LIM. 1 hit.
PF00595. PDZ. 1 hit.
[Graphical view ]
SMARTi SM00132. LIM. 1 hit.
SM00228. PDZ. 1 hit.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 1 hit.
PROSITEi PS00478. LIM_DOMAIN_1. 1 hit.
PS50023. LIM_DOMAIN_2. 1 hit.
PS50106. PDZ. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Mystique, a PDZ-LIM protein with one carboxyl terminal LIM domain."
    Lau Y.M., Kotaka M., Chan A.H., Lee S.M.Y., Au C.C., Chim S.S.C., Kok L.D.S., Ng E.K.O., Siu S.S., Yiu S.W.H., Fung K.P., Waye M.M.Y., Tsui S.K.W., Lee C.Y.
    Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  2. Guo J.H., Zan Q., Yu L.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Hypothalamus.
  3. "Cloning a novel protein containing PDZ and LIM domains."
    Shan Y.X., Yu L., Huang C.Q.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  4. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Characterization of long cDNA clones from human adult spleen."
    Hattori A., Okumura K., Nagase T., Kikuno R., Hirosawa M., Ohara O.
    DNA Res. 7:357-366(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Spleen.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Spleen.
  7. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Placenta.
  10. "Mystique is a new IGF-I regulated PDZ-LIM domain protein that promotes cell attachment and migration and suppresses anchorage independent growth."
    Loughran G., Healy N., Kiely P.A., Huigsloot M., Kedersha N.L., O'connor R.
    Mol. Biol. Cell 16:1811-1822(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-80; CYS-313 AND CYS-316.
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Structure of the PDZ domain of human PDLIM2 bound to a C-terminal extension from human beta-tropomyosin."
    Structural genomics consortium (SGC)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 1-82.

Entry informationi

Entry nameiPDLI2_HUMAN
AccessioniPrimary (citable) accession number: Q96JY6
Secondary accession number(s): D3DSR5
, J3KNH4, Q7Z584, Q86WM8, Q8WZ29, Q9H4L9, Q9H7I2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi