Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 136

Gene

CCDC136

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 136
Alternative name(s):
Nasopharyngeal carcinoma-associated gene 6 protein
Gene namesi
Name:CCDC136
Synonyms:KIAA1793
ORF Names:NAG6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22225. CCDC136.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei1130 – 115021HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrion Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162381381.

Polymorphism and mutation databases

BioMutaiCCDC136.
DMDMi296439415.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11541154Coiled-coil domain-containing protein 136PRO_0000300639Add
BLAST

Proteomic databases

MaxQBiQ96JN2.
PaxDbiQ96JN2.
PRIDEiQ96JN2.

PTM databases

PhosphoSiteiQ96JN2.

Expressioni

Tissue specificityi

Expressed in gastric tissues. Down-regulated in gastric cancer.1 Publication

Gene expression databases

BgeeiQ96JN2.
CleanExiHS_CCDC136.
ExpressionAtlasiQ96JN2. baseline and differential.
GenevestigatoriQ96JN2.

Organism-specific databases

HPAiHPA010647.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
A8KAD63EBI-10171416,EBI-10174974
Q9H6F03EBI-10171416,EBI-10307481
ABT1Q9ULW33EBI-10171416,EBI-2602396
AQP1P299723EBI-10171416,EBI-745213
ASB7Q9H6723EBI-10171416,EBI-3916346
ATP5OP480473EBI-10171416,EBI-355815
BARD1A0AVN23EBI-10171416,EBI-9977322
BLOC1S6Q9UL453EBI-10171416,EBI-465781
BYSLQ138955EBI-10171416,EBI-358049
C19orf66Q9NUL53EBI-10171416,EBI-10313866
C1orf216Q8TAB53EBI-10171416,EBI-747505
CBX8Q9HC523EBI-10171416,EBI-712912
CCDC146Q8IYE0-23EBI-10171416,EBI-10247802
CCHCR1Q8TD31-33EBI-10171416,EBI-10175300
CDK2AP1O145193EBI-10171416,EBI-1052532
CEP57L1Q8IYX83EBI-10171416,EBI-1104570
CEP57L1Q8IYX8-23EBI-10171416,EBI-10181988
ENKD1Q9H0I23EBI-10171416,EBI-744099
FAM107AO95990-33EBI-10171416,EBI-10192902
FAM161AQ3B8203EBI-10171416,EBI-719941
HAUS1Q96CS23EBI-10171416,EBI-2514791
HDAC4P565243EBI-10171416,EBI-308629
HMG20AQ9NP663EBI-10171416,EBI-740641
HMG20BQ9P0W23EBI-10171416,EBI-713401
JMYQ8N9B5-23EBI-10171416,EBI-10268138
KANSL1I3L4J33EBI-10171416,EBI-10178305
KAT5Q929933EBI-10171416,EBI-399080
KIFC3Q9BVG83EBI-10171416,EBI-2125614
LENG1Q96BZ83EBI-10171416,EBI-726510
MAGEB4O154813EBI-10171416,EBI-751857
MOSP005403EBI-10171416,EBI-1757866
PDLIM5Q96HC43EBI-10171416,EBI-751267
PPP1R18Q6NYC83EBI-10171416,EBI-2557469
PRPF31F1T0A53EBI-10171416,EBI-10177194
PSMD9O002333EBI-10171416,EBI-750973
RAB33AQ140883EBI-10171416,EBI-744685
SMARCE1Q969G33EBI-10171416,EBI-455078
TBRG1Q05BL03EBI-10171416,EBI-10223693
TCEA2Q155603EBI-10171416,EBI-710310
TNNT1P138053EBI-10171416,EBI-726527
TXLNAP402225EBI-10171416,EBI-359793
USP2O756043EBI-10171416,EBI-743272
ZC2HC1CQ53FD03EBI-10171416,EBI-740767
ZNF20P170243EBI-10171416,EBI-717634
ZNF230Q9UIE03EBI-10171416,EBI-1105361
ZNF250P15622-33EBI-10171416,EBI-10177272
ZNF417Q8TAU33EBI-10171416,EBI-740727
ZNF490Q9ULM23EBI-10171416,EBI-1105370
ZNF564Q8TBZ83EBI-10171416,EBI-10273713
ZNF572A1L4E93EBI-10171416,EBI-10172590
ZNF572Q7Z3I73EBI-10171416,EBI-10257016
ZNF581Q9P0T43EBI-10171416,EBI-745520
ZNF587Q96SQ53EBI-10171416,EBI-6427977
ZSCAN26Q166703EBI-10171416,EBI-3920053

Protein-protein interaction databases

BioGridi122267. 62 interactions.
IntActiQ96JN2. 62 interactions.
STRINGi9606.ENSP00000297788.

Structurei

3D structure databases

ProteinModelPortaliQ96JN2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili696 – 73338Sequence AnalysisAdd
BLAST
Coiled coili859 – 974116Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi5 – 337333Glu-richAdd
BLAST
Compositional biasi771 – 83464Ser-richAdd
BLAST
Compositional biasi1036 – 111075Glu-richAdd
BLAST

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG131615.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG107598.
InParanoidiQ96JN2.
OMAiQLQMEQC.
OrthoDBiEOG7X0VGH.
PhylomeDBiQ96JN2.
TreeFamiTF350490.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96JN2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAMEGEVLL PALYEEEEEE EEEEEEVEEE EEQVQKGGSV GSLSVNKHRG
60 70 80 90 100
LSLTETELEE LRAQVLQLVA ELEETRELAG QHEDDSLELQ GLLEDERLAS
110 120 130 140 150
AQQAEVFTKQ IQQLQGELRS LREEISLLEH EKESELKEIE QELHLAQAEI
160 170 180 190 200
QSLRQAAEDS ATEHESDIAS LQEDLCRMQN ELEDMERIRG DYEMEIASLR
210 220 230 240 250
AEMEMKSSEP SGSLGLSDYS GLQEELQELR ERYHFLNEEY RALQESNSSL
260 270 280 290 300
TGQLADLESE RTQRATERWL QSQTLSMTSA ESQTSEMDFL EPDPEMQLLR
310 320 330 340 350
QQLRDAEEQM HGMKNKCQEL CCELEELQHH RQVSEEEQRR LQRELKCAQN
360 370 380 390 400
EVLRFQTSHS VTQNEELKSR LCTLQKKYDT SQDEQNELLK MQLQLQTELR
410 420 430 440 450
QLKVMKSTLV ENQSEKELLC RLQKLHLQHQ NVTCEKEKLL ERQQQLQEEL
460 470 480 490 500
QCHEAELQHL RDTVASFKES NEKDTETHAQ LQEMKQLYQA SKDELERQKH
510 520 530 540 550
MYDQLEQDLL LCQLELKELK ASHPIPEDKG KCANKCDTLL SRLTELQEKY
560 570 580 590 600
KASQKEMGQL QMEQCELLED QRRMQEEQGQ LQEELHRLTL PLPKSGLLLK
610 620 630 640 650
SQELLTKLED LCELQLLYQG MQEEQKKLIQ NQDCVLKEQL EIHEELRRFK
660 670 680 690 700
ESHFQEVLEN PDDSKLAKSS KCNRNKQSKL LMEQMQALQV MYDAGQAKQE
710 720 730 740 750
LLQQEQGRLL EERKRLQADL QLCLEEMQLL QVQSPSIKMS LESYGKSYGS
760 770 780 790 800
MVPSNENCRK TYDTTVDDNE SYYKSYTSTQ TSSKSFLKSY DSSTSASEAY
810 820 830 840 850
GKSYCTTSNS SITYKKSYGS TSSSDTCQKS FVSSCTDEEP AEPEDMERFE
860 870 880 890 900
EMVVKVLIKL QAVQAMYQIS QEEHSQLQEQ MEKLLAKQKD LKEELDACER
910 920 930 940 950
EFKECMECLE KPMAPQNDKN EIKELQTKLR ELQLQYQASM DEQGRLLVVQ
960 970 980 990 1000
EQLEGQLQCC QEELRQLREK RPSVVKEARG KNANKNMNKN ANGVKMKKVT
1010 1020 1030 1040 1050
KPCSDTSESD LETRKSLEVV LYYKASQRKL DGLAKEEEKK EEMEEEKKQV
1060 1070 1080 1090 1100
KEEAKEQCGD ELVAEPADPE EAKSTEDQEE NEEDKEEEEK EEDSEEEEDD
1110 1120 1130 1140 1150
ADSSLESPEE NNPLRLSESK KSSPTPNPPI FSLPLVGLVV ISALLWCWWA

ETSS
Length:1,154
Mass (Da):134,045
Last modified:May 18, 2010 - v3
Checksum:iFBB50829AB97E425
GO
Isoform 2 (identifier: Q96JN2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     922-957: IKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQL → NMFGLWKPMVFLAIAAVALYVLPNMRQQESEFCLME
     958-1154: Missing.

Note: No experimental confirmation available.

Show »
Length:957
Mass (Da):111,548
Checksum:iDD6A801C6E538D62
GO
Isoform 3 (identifier: Q96JN2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEAGAGAGAGAAGWSCPGPGPTVTTLGSYEASEGCERKKGQRWGSLERRGM
     212-223: Missing.
     364-1121: Missing.

Note: No experimental confirmation available.

Show »
Length:434
Mass (Da):49,449
Checksum:iF3C01606AC2030A3
GO
Isoform 4 (identifier: Q96JN2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1122-1154: SSPTPNPPIFSLPLVGLVVISALLWCWWAETSS → NMFGLWKPMVFLAIAAVALYVLPNMRQQESEFCLME

Note: No experimental confirmation available.

Show »
Length:1,157
Mass (Da):134,668
Checksum:iA96EF279E8202DAD
GO

Sequence cautioni

The sequence AF156971 differs from that shown.Intron retention.Curated
The sequence BAB14590.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB47422.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti263 – 2642QR → HG in CAB61359 (PubMed:17974005).Curated
Sequence conflicti490 – 4901A → V in BAB14590 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti218 – 2181D → H.
Corresponds to variant rs3816887 [ dbSNP | Ensembl ].
VAR_034880
Natural varianti1049 – 10491Q → E.5 Publications
Corresponds to variant rs4728137 [ dbSNP | Ensembl ].
VAR_034881

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MEAGAGAGAGAAGWSCPGPG PTVTTLGSYEASEGCERKKG QRWGSLERRGM in isoform 3. 1 PublicationVSP_027840
Alternative sequencei212 – 22312Missing in isoform 3. 1 PublicationVSP_027841Add
BLAST
Alternative sequencei364 – 1121758Missing in isoform 3. 1 PublicationVSP_027842Add
BLAST
Alternative sequencei922 – 95736IKELQ…LEGQL → NMFGLWKPMVFLAIAAVALY VLPNMRQQESEFCLME in isoform 2. 1 PublicationVSP_027843Add
BLAST
Alternative sequencei958 – 1154197Missing in isoform 2. 1 PublicationVSP_027844Add
BLAST
Alternative sequencei1122 – 115433SSPTP…AETSS → NMFGLWKPMVFLAIAAVALY VLPNMRQQESEFCLME in isoform 4. 2 PublicationsVSP_027845Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB058696 mRNA. Translation: BAB47422.1. Different initiation.
AK023500 mRNA. Translation: BAB14590.1. Different initiation.
AK124447 mRNA. Translation: BAC85854.1.
AC024952 Genomic DNA. No translation available.
AC025594 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24111.1.
CH471070 Genomic DNA. Translation: EAW83682.1.
CH471070 Genomic DNA. Translation: EAW83684.1.
BC150331 mRNA. Translation: AAI50332.1.
BC152408 mRNA. Translation: AAI52409.1.
AL133027 mRNA. Translation: CAB61359.1.
AF156971 mRNA. No translation available.
CCDSiCCDS47704.1. [Q96JN2-1]
CCDS56510.1. [Q96JN2-3]
PIRiT42701.
RefSeqiNP_001188301.1. NM_001201372.1. [Q96JN2-3]
NP_073579.4. NM_022742.4.
UniGeneiHs.521178.

Genome annotation databases

EnsembliENST00000297788; ENSP00000297788; ENSG00000128596. [Q96JN2-1]
ENST00000378685; ENSP00000367956; ENSG00000128596. [Q96JN2-3]
GeneIDi64753.
KEGGihsa:64753.
UCSCiuc003vnu.2. human. [Q96JN2-3]
uc003vnv.2. human. [Q96JN2-1]
uc003vny.2. human. [Q96JN2-2]

Polymorphism and mutation databases

BioMutaiCCDC136.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB058696 mRNA. Translation: BAB47422.1. Different initiation.
AK023500 mRNA. Translation: BAB14590.1. Different initiation.
AK124447 mRNA. Translation: BAC85854.1.
AC024952 Genomic DNA. No translation available.
AC025594 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24111.1.
CH471070 Genomic DNA. Translation: EAW83682.1.
CH471070 Genomic DNA. Translation: EAW83684.1.
BC150331 mRNA. Translation: AAI50332.1.
BC152408 mRNA. Translation: AAI52409.1.
AL133027 mRNA. Translation: CAB61359.1.
AF156971 mRNA. No translation available.
CCDSiCCDS47704.1. [Q96JN2-1]
CCDS56510.1. [Q96JN2-3]
PIRiT42701.
RefSeqiNP_001188301.1. NM_001201372.1. [Q96JN2-3]
NP_073579.4. NM_022742.4.
UniGeneiHs.521178.

3D structure databases

ProteinModelPortaliQ96JN2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122267. 62 interactions.
IntActiQ96JN2. 62 interactions.
STRINGi9606.ENSP00000297788.

PTM databases

PhosphoSiteiQ96JN2.

Polymorphism and mutation databases

BioMutaiCCDC136.
DMDMi296439415.

Proteomic databases

MaxQBiQ96JN2.
PaxDbiQ96JN2.
PRIDEiQ96JN2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297788; ENSP00000297788; ENSG00000128596. [Q96JN2-1]
ENST00000378685; ENSP00000367956; ENSG00000128596. [Q96JN2-3]
GeneIDi64753.
KEGGihsa:64753.
UCSCiuc003vnu.2. human. [Q96JN2-3]
uc003vnv.2. human. [Q96JN2-1]
uc003vny.2. human. [Q96JN2-2]

Organism-specific databases

CTDi64753.
GeneCardsiGC07P128430.
HGNCiHGNC:22225. CCDC136.
HPAiHPA010647.
MIMi611902. gene.
neXtProtiNX_Q96JN2.
PharmGKBiPA162381381.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG131615.
GeneTreeiENSGT00530000063197.
HOVERGENiHBG107598.
InParanoidiQ96JN2.
OMAiQLQMEQC.
OrthoDBiEOG7X0VGH.
PhylomeDBiQ96JN2.
TreeFamiTF350490.

Miscellaneous databases

GenomeRNAii64753.
NextBioi66713.
PROiQ96JN2.
SOURCEiSearch...

Gene expression databases

BgeeiQ96JN2.
CleanExiHS_CCDC136.
ExpressionAtlasiQ96JN2. baseline and differential.
GenevestigatoriQ96JN2.

Family and domain databases

ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-1049.
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 410-1154 (ISOFORM 2).
    Tissue: Cerebellum and Placenta.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1049.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1049.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-1049.
    Tissue: Brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-1154 (ISOFORM 4), VARIANT GLU-1049.
    Tissue: Testis.
  8. "Expression of tumor related gene NAG6 in gastric cancer and restriction fragment length polymorphism analysis."
    Zhang X.-M., Sheng S.-R., Wang X.-Y., Bin L.-H., Wang J.-R., Li G.-Y.
    World J. Gastroenterol. 10:1361-1364(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1128-1154 (ISOFORM 4), TISSUE SPECIFICITY.
    Tissue: Nasopharyngeal carcinoma.

Entry informationi

Entry nameiCC136_HUMAN
AccessioniPrimary (citable) accession number: Q96JN2
Secondary accession number(s): A4D1K1
, A7MCY7, A8MYA7, Q6ZVK7, Q9H8M3, Q9UFE1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: May 18, 2010
Last modified: April 29, 2015
This is version 85 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Restriction fragment length polymorphisms (RFLPs) in gastric cancer showed loss of 5 kb fragment in comparison with the corresponding normal tissue.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.