Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JN2

- CC136_HUMAN

UniProt

Q96JN2 - CC136_HUMAN

Protein

Coiled-coil domain-containing protein 136

Gene

CCDC136

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 81 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Coiled-coil domain-containing protein 136
    Alternative name(s):
    Nasopharyngeal carcinoma-associated gene 6 protein
    Gene namesi
    Name:CCDC136
    Synonyms:KIAA1793
    ORF Names:NAG6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:22225. CCDC136.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrion Source: Ensembl

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162381381.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11541154Coiled-coil domain-containing protein 136PRO_0000300639Add
    BLAST

    Proteomic databases

    MaxQBiQ96JN2.
    PaxDbiQ96JN2.
    PRIDEiQ96JN2.

    PTM databases

    PhosphoSiteiQ96JN2.

    Expressioni

    Tissue specificityi

    Expressed in gastric tissues. Down-regulated in gastric cancer.1 Publication

    Gene expression databases

    ArrayExpressiQ96JN2.
    BgeeiQ96JN2.
    CleanExiHS_CCDC136.
    GenevestigatoriQ96JN2.

    Organism-specific databases

    HPAiHPA010647.

    Interactioni

    Protein-protein interaction databases

    BioGridi122267. 8 interactions.
    IntActiQ96JN2. 8 interactions.
    STRINGi9606.ENSP00000297788.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96JN2.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1130 – 115021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili696 – 73338Sequence AnalysisAdd
    BLAST
    Coiled coili859 – 974116Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi5 – 337333Glu-richAdd
    BLAST
    Compositional biasi771 – 83464Ser-richAdd
    BLAST
    Compositional biasi1036 – 111075Glu-richAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG131615.
    HOVERGENiHBG107598.
    InParanoidiQ96JN2.
    OMAiQLQMEQC.
    OrthoDBiEOG7X0VGH.
    PhylomeDBiQ96JN2.
    TreeFamiTF350490.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JN2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQAMEGEVLL PALYEEEEEE EEEEEEVEEE EEQVQKGGSV GSLSVNKHRG     50
    LSLTETELEE LRAQVLQLVA ELEETRELAG QHEDDSLELQ GLLEDERLAS 100
    AQQAEVFTKQ IQQLQGELRS LREEISLLEH EKESELKEIE QELHLAQAEI 150
    QSLRQAAEDS ATEHESDIAS LQEDLCRMQN ELEDMERIRG DYEMEIASLR 200
    AEMEMKSSEP SGSLGLSDYS GLQEELQELR ERYHFLNEEY RALQESNSSL 250
    TGQLADLESE RTQRATERWL QSQTLSMTSA ESQTSEMDFL EPDPEMQLLR 300
    QQLRDAEEQM HGMKNKCQEL CCELEELQHH RQVSEEEQRR LQRELKCAQN 350
    EVLRFQTSHS VTQNEELKSR LCTLQKKYDT SQDEQNELLK MQLQLQTELR 400
    QLKVMKSTLV ENQSEKELLC RLQKLHLQHQ NVTCEKEKLL ERQQQLQEEL 450
    QCHEAELQHL RDTVASFKES NEKDTETHAQ LQEMKQLYQA SKDELERQKH 500
    MYDQLEQDLL LCQLELKELK ASHPIPEDKG KCANKCDTLL SRLTELQEKY 550
    KASQKEMGQL QMEQCELLED QRRMQEEQGQ LQEELHRLTL PLPKSGLLLK 600
    SQELLTKLED LCELQLLYQG MQEEQKKLIQ NQDCVLKEQL EIHEELRRFK 650
    ESHFQEVLEN PDDSKLAKSS KCNRNKQSKL LMEQMQALQV MYDAGQAKQE 700
    LLQQEQGRLL EERKRLQADL QLCLEEMQLL QVQSPSIKMS LESYGKSYGS 750
    MVPSNENCRK TYDTTVDDNE SYYKSYTSTQ TSSKSFLKSY DSSTSASEAY 800
    GKSYCTTSNS SITYKKSYGS TSSSDTCQKS FVSSCTDEEP AEPEDMERFE 850
    EMVVKVLIKL QAVQAMYQIS QEEHSQLQEQ MEKLLAKQKD LKEELDACER 900
    EFKECMECLE KPMAPQNDKN EIKELQTKLR ELQLQYQASM DEQGRLLVVQ 950
    EQLEGQLQCC QEELRQLREK RPSVVKEARG KNANKNMNKN ANGVKMKKVT 1000
    KPCSDTSESD LETRKSLEVV LYYKASQRKL DGLAKEEEKK EEMEEEKKQV 1050
    KEEAKEQCGD ELVAEPADPE EAKSTEDQEE NEEDKEEEEK EEDSEEEEDD 1100
    ADSSLESPEE NNPLRLSESK KSSPTPNPPI FSLPLVGLVV ISALLWCWWA 1150
    ETSS 1154
    Length:1,154
    Mass (Da):134,045
    Last modified:May 18, 2010 - v3
    Checksum:iFBB50829AB97E425
    GO
    Isoform 2 (identifier: Q96JN2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         922-957: IKELQTKLRELQLQYQASMDEQGRLLVVQEQLEGQL → NMFGLWKPMVFLAIAAVALYVLPNMRQQESEFCLME
         958-1154: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:957
    Mass (Da):111,548
    Checksum:iDD6A801C6E538D62
    GO
    Isoform 3 (identifier: Q96JN2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MEAGAGAGAGAAGWSCPGPGPTVTTLGSYEASEGCERKKGQRWGSLERRGM
         212-223: Missing.
         364-1121: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:434
    Mass (Da):49,449
    Checksum:iF3C01606AC2030A3
    GO
    Isoform 4 (identifier: Q96JN2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1122-1154: SSPTPNPPIFSLPLVGLVVISALLWCWWAETSS → NMFGLWKPMVFLAIAAVALYVLPNMRQQESEFCLME

    Note: No experimental confirmation available.

    Show »
    Length:1,157
    Mass (Da):134,668
    Checksum:iA96EF279E8202DAD
    GO

    Sequence cautioni

    The sequence AF156971 differs from that shown. Reason: Intron retention.
    The sequence BAB14590.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB47422.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti263 – 2642QR → HG in CAB61359. (PubMed:17974005)Curated
    Sequence conflicti490 – 4901A → V in BAB14590. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti218 – 2181D → H.
    Corresponds to variant rs3816887 [ dbSNP | Ensembl ].
    VAR_034880
    Natural varianti1049 – 10491Q → E.5 Publications
    Corresponds to variant rs4728137 [ dbSNP | Ensembl ].
    VAR_034881

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MEAGAGAGAGAAGWSCPGPG PTVTTLGSYEASEGCERKKG QRWGSLERRGM in isoform 3. 1 PublicationVSP_027840
    Alternative sequencei212 – 22312Missing in isoform 3. 1 PublicationVSP_027841Add
    BLAST
    Alternative sequencei364 – 1121758Missing in isoform 3. 1 PublicationVSP_027842Add
    BLAST
    Alternative sequencei922 – 95736IKELQ…LEGQL → NMFGLWKPMVFLAIAAVALY VLPNMRQQESEFCLME in isoform 2. 1 PublicationVSP_027843Add
    BLAST
    Alternative sequencei958 – 1154197Missing in isoform 2. 1 PublicationVSP_027844Add
    BLAST
    Alternative sequencei1122 – 115433SSPTP…AETSS → NMFGLWKPMVFLAIAAVALY VLPNMRQQESEFCLME in isoform 4. 2 PublicationsVSP_027845Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB058696 mRNA. Translation: BAB47422.1. Different initiation.
    AK023500 mRNA. Translation: BAB14590.1. Different initiation.
    AK124447 mRNA. Translation: BAC85854.1.
    AC024952 Genomic DNA. No translation available.
    AC025594 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24111.1.
    CH471070 Genomic DNA. Translation: EAW83682.1.
    CH471070 Genomic DNA. Translation: EAW83684.1.
    BC150331 mRNA. Translation: AAI50332.1.
    BC152408 mRNA. Translation: AAI52409.1.
    AL133027 mRNA. Translation: CAB61359.1.
    AF156971 mRNA. No translation available.
    CCDSiCCDS47704.1. [Q96JN2-1]
    CCDS56510.1. [Q96JN2-3]
    PIRiT42701.
    RefSeqiNP_001188301.1. NM_001201372.1. [Q96JN2-3]
    NP_073579.4. NM_022742.4.
    UniGeneiHs.521178.

    Genome annotation databases

    EnsembliENST00000297788; ENSP00000297788; ENSG00000128596. [Q96JN2-1]
    ENST00000378685; ENSP00000367956; ENSG00000128596. [Q96JN2-3]
    GeneIDi64753.
    KEGGihsa:64753.
    UCSCiuc003vnu.2. human. [Q96JN2-3]
    uc003vnv.2. human. [Q96JN2-1]
    uc003vny.2. human. [Q96JN2-2]

    Polymorphism databases

    DMDMi296439415.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB058696 mRNA. Translation: BAB47422.1 . Different initiation.
    AK023500 mRNA. Translation: BAB14590.1 . Different initiation.
    AK124447 mRNA. Translation: BAC85854.1 .
    AC024952 Genomic DNA. No translation available.
    AC025594 Genomic DNA. No translation available.
    CH236950 Genomic DNA. Translation: EAL24111.1 .
    CH471070 Genomic DNA. Translation: EAW83682.1 .
    CH471070 Genomic DNA. Translation: EAW83684.1 .
    BC150331 mRNA. Translation: AAI50332.1 .
    BC152408 mRNA. Translation: AAI52409.1 .
    AL133027 mRNA. Translation: CAB61359.1 .
    AF156971 mRNA. No translation available.
    CCDSi CCDS47704.1. [Q96JN2-1 ]
    CCDS56510.1. [Q96JN2-3 ]
    PIRi T42701.
    RefSeqi NP_001188301.1. NM_001201372.1. [Q96JN2-3 ]
    NP_073579.4. NM_022742.4.
    UniGenei Hs.521178.

    3D structure databases

    ProteinModelPortali Q96JN2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122267. 8 interactions.
    IntActi Q96JN2. 8 interactions.
    STRINGi 9606.ENSP00000297788.

    PTM databases

    PhosphoSitei Q96JN2.

    Polymorphism databases

    DMDMi 296439415.

    Proteomic databases

    MaxQBi Q96JN2.
    PaxDbi Q96JN2.
    PRIDEi Q96JN2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000297788 ; ENSP00000297788 ; ENSG00000128596 . [Q96JN2-1 ]
    ENST00000378685 ; ENSP00000367956 ; ENSG00000128596 . [Q96JN2-3 ]
    GeneIDi 64753.
    KEGGi hsa:64753.
    UCSCi uc003vnu.2. human. [Q96JN2-3 ]
    uc003vnv.2. human. [Q96JN2-1 ]
    uc003vny.2. human. [Q96JN2-2 ]

    Organism-specific databases

    CTDi 64753.
    GeneCardsi GC07P128430.
    HGNCi HGNC:22225. CCDC136.
    HPAi HPA010647.
    MIMi 611902. gene.
    neXtProti NX_Q96JN2.
    PharmGKBi PA162381381.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG131615.
    HOVERGENi HBG107598.
    InParanoidi Q96JN2.
    OMAi QLQMEQC.
    OrthoDBi EOG7X0VGH.
    PhylomeDBi Q96JN2.
    TreeFami TF350490.

    Miscellaneous databases

    GenomeRNAii 64753.
    NextBioi 66713.
    PROi Q96JN2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96JN2.
    Bgeei Q96JN2.
    CleanExi HS_CCDC136.
    Genevestigatori Q96JN2.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-1049.
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 410-1154 (ISOFORM 2).
      Tissue: Cerebellum and Placenta.
    3. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1049.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-1049.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT GLU-1049.
      Tissue: Brain.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 125-1154 (ISOFORM 4), VARIANT GLU-1049.
      Tissue: Testis.
    8. "Expression of tumor related gene NAG6 in gastric cancer and restriction fragment length polymorphism analysis."
      Zhang X.-M., Sheng S.-R., Wang X.-Y., Bin L.-H., Wang J.-R., Li G.-Y.
      World J. Gastroenterol. 10:1361-1364(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1128-1154 (ISOFORM 4), TISSUE SPECIFICITY.
      Tissue: Nasopharyngeal carcinoma.

    Entry informationi

    Entry nameiCC136_HUMAN
    AccessioniPrimary (citable) accession number: Q96JN2
    Secondary accession number(s): A4D1K1
    , A7MCY7, A8MYA7, Q6ZVK7, Q9H8M3, Q9UFE1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 81 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Restriction fragment length polymorphisms (RFLPs) in gastric cancer showed loss of 5 kb fragment in comparison with the corresponding normal tissue.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3