Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96JM2 (ZN462_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 462
Gene names
Name:ZNF462
Synonyms:KIAA1803
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length2506 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subcellular location

Nucleus Potential.

Post-translational modification

O-GlcNAcylated with O-GlcNAc-6-phosphate.

Sequence similarities

Contains 27 C2H2-type zinc fingers.

Sequence caution

The sequence AAH36884.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96JM2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96JM2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1155: Missing.
     2004-2004: K → KQEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96JM2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     2004-2004: K → KEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 25062506Zinc finger protein 462
PRO_0000047601

Regions

Zinc finger4 – 2724C2H2-type 1
Zinc finger108 – 13124C2H2-type 2
Zinc finger162 – 18524C2H2-type 3
Zinc finger439 – 46224C2H2-type 4
Zinc finger470 – 49223C2H2-type 5
Zinc finger600 – 62324C2H2-type 6
Zinc finger843 – 86624C2H2-type 7
Zinc finger886 – 90823C2H2-type 8
Zinc finger925 – 94824C2H2-type 9
Zinc finger1030 – 105324C2H2-type 10
Zinc finger1265 – 128824C2H2-type 11
Zinc finger1470 – 149324C2H2-type 12
Zinc finger1515 – 153824C2H2-type 13
Zinc finger1577 – 160024C2H2-type 14
Zinc finger1660 – 168324C2H2-type 15
Zinc finger1697 – 172024C2H2-type 16
Zinc finger1892 – 191423C2H2-type 17
Zinc finger1968 – 199225C2H2-type 18; degenerate
Zinc finger2025 – 204824C2H2-type 19
Zinc finger2054 – 207724C2H2-type 20
Zinc finger2083 – 210624C2H2-type 21
Zinc finger2191 – 221424C2H2-type 22
Zinc finger2220 – 224324C2H2-type 23
Zinc finger2254 – 227623C2H2-type 24
Zinc finger2300 – 232223C2H2-type 25
Zinc finger2328 – 235124C2H2-type 26
Zinc finger2414 – 243623C2H2-type 27

Amino acid modifications

Modified residue3501Phosphoserine Ref.7
Modified residue3541Phosphoserine Ref.7
Modified residue6881Phosphoserine Ref.6 Ref.7
Modified residue10901Phosphoserine Ref.7
Modified residue11661Phosphoserine Ref.7
Modified residue21721Phosphoserine Ref.7
Modified residue21771Phosphoserine Ref.7
Glycosylation2921O-linked (GlcNAc6P) Ref.8
Glycosylation3091O-linked (GlcNAc6P) Ref.8

Natural variations

Alternative sequence1 – 11551155Missing in isoform 2.
VSP_037407
Alternative sequence20041K → KQEADDPAHLFLDGLEAAKD ASGALVGRVDGEHCLLDGML EDETRPGGYHCSQCDRVLMS MQ in isoform 2.
VSP_037408
Alternative sequence20041K → KEADDPAHLFLDGLEAAKDA SGALVGRVDGEHCLLDGMLE DETRPGGYHCSQCDRVLMSM Q in isoform 3.
VSP_037409
Natural variant4041M → V.
Corresponds to variant rs17723637 [ dbSNP | Ensembl ].
VAR_058301
Natural variant11871P → S.
Corresponds to variant rs3814541 [ dbSNP | Ensembl ].
VAR_058302
Natural variant18281N → S.
Corresponds to variant rs3814538 [ dbSNP | Ensembl ].
VAR_058303
Natural variant20521K → R.
Corresponds to variant rs7020769 [ dbSNP | Ensembl ].
VAR_058304
Natural variant24521H → L.
Corresponds to variant rs10217192 [ dbSNP | Ensembl ].
VAR_058305

Experimental info

Sequence conflict12411Q → R in AK027866. Ref.4
Sequence conflict12501V → I in AK027866. Ref.4
Sequence conflict13321Q → R in AK027866. Ref.4
Sequence conflict14241A → T in AK027866. Ref.4
Sequence conflict14301E → A in AK027866. Ref.4
Sequence conflict19361K → E in AK027866. Ref.4
Sequence conflict20301C → S in AK027866. Ref.4
Sequence conflict22771Missing in AK027866. Ref.4

Secondary structure

........ 2506
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 26, 2009. Version 3.
Checksum: BE921753A66384DB

FASTA2,506284,688
        10         20         30         40         50         60 
MEVLQCDGCD FRAPSYEDLK AHIQDVHTAF LQPTDVAEDN VNELRCGSVN ASNQTEVEFS 

        70         80         90        100        110        120 
SIKDEFAIAE DLSGQNATSL GTGGYYGHSP GYYGQHIAAN PKPTNKFFQC KFCVRYFRSK 

       130        140        150        160        170        180 
NLLIEHTRKV HGAQAEGSSS GPPVPGSLNY NIMMHEGFGK VFSCQFCTYK SPRRARIIKH 

       190        200        210        220        230        240 
QKMYHKNNLK ETTAPPPAPA PMPDPVVPPV SLQDPCKELP AEVVERSILE SMVKPLTKSR 

       250        260        270        280        290        300 
GNFCCEWCSY QTPRRERWCD HMMKKHRSMV KILSSLRQQQ EGTNLPDVPN KSAPSPTSNS 

       310        320        330        340        350        360 
TYLTMNAASR EIPNTTVSNF RGSMGNSIMR PNSSASKFSP MSYPQMKPKS PHNSGLVNLT 

       370        380        390        400        410        420 
ERSRYGMTDM TNSSADLETN SMLNDSSSDE ELNEIDSENG LSAMDHQTSG LSAEQLMGSD 

       430        440        450        460        470        480 
GNKLLETKGI PFRRFMNRFQ CPFCPFLTMH RRSISRHIEN IHLSGKTAVY KCDECPFTCK 

       490        500        510        520        530        540 
SSLKLGAHKQ CHTGTTSDWD AVNSQSESIS SSLNEGVVSY ESSSINGRKS GVMLDPLQQQ 

       550        560        570        580        590        600 
QPPQPPPPPP PPPPSQPQPL QQPQPPQLQP PHQVPPQPQT QPPPTQQPQP PTQAAPLHPY 

       610        620        630        640        650        660 
KCTMCNYSTT TLKGLRVHQQ HKHSFCDNLP KFEGQPSSLP LENETDSHPS SSNTVKKSQT 

       670        680        690        700        710        720 
SILGLSSKNN FVAKASRKLA NDFPLDLSPV KKRTRIDEIA SNLQSKINQT KQQEDAVINV 

       730        740        750        760        770        780 
EDDEEEEEDN EVEIEVELDR EEEPTEPIIE VPTSFSAQQI WVRDTSEPQK EPNFRNITHD 

       790        800        810        820        830        840 
YNATNGAEIE LTLSEDEEDY YGSSTNLKDH QVSNTALLNT QTPIYGTEHN SENTDFGDSG 

       850        860        870        880        890        900 
RLYYCKHCDF NNKSARSVST HYQRMHPYIK FSFRYILDPN DHSAVYRCLE CYIDYTNFED 

       910        920        930        940        950        960 
LQQHYGEHHP EAMNVLNFDH SDLIYRCRFC SYTSPNVRSL MPHYQRMHPT VKINNAMIFS 

       970        980        990       1000       1010       1020 
SYVVEQQEGL NTESQTLREI LNSAPKNMAT STPVARGGGL PATFNKNTPK TFTPECENQK 

      1030       1040       1050       1060       1070       1080 
DPLVNTVVVY DCDVCSFASP NMHSVLVHYQ KKHPEEKASY FRIQKTMRMV SVDRGSALSQ 

      1090       1100       1110       1120       1130       1140 
LSFEVGAPMS PKMSNMGSPP PPQPPPPDLS TELYYCKHCS YSNRSVVGVL VHYQKRHPEI 

      1150       1160       1170       1180       1190       1200 
KVTAKYIRQA PPTAAMMRGV EGPQGSPRPP APIQQLNRSS SERDGPPVEN EMFFCQHCDY 

      1210       1220       1230       1240       1250       1260 
GNRTVKGVLI HYQKKHRDFK ANADVIRQHT ATIRSLCDRN QKKPASCVLV SPSNLERDKT 

      1270       1280       1290       1300       1310       1320 
KLRALKCRQC SYTSPYFYAL RKHIKKDHPA LKATVTSIMR WAFLDGLIEA GYHCEWCIYS 

      1330       1340       1350       1360       1370       1380 
HTEPNGLLLH YQRRHPEHYV DYTYMATKLW AGPDPSPPSL TMPAEAKTYR CRDCVFEAVS 

      1390       1400       1410       1420       1430       1440 
IWDITNHYQA FHPWAMNGDE SVLLDIIKEK DAVEKPILSS EELAGPVNCE NSIPTPFPEQ 

      1450       1460       1470       1480       1490       1500 
EAECPEDARL SPEKSLQLAS ANPAISSTPY QCTVCQSEYN NLHGLLTHYG KKHPGMKVKA 

      1510       1520       1530       1540       1550       1560 
ADFAQDIDIN PGAVYKCRHC PYINTRIHGV LTHYQKRHPS IKVTAEDFVH DVEQSADISQ 

      1570       1580       1590       1600       1610       1620 
NDVEETSRIF KQGYGAYRCK LCPYTHGTLE KLKIHYEKYH NQPEFDVFSQ SPPKLPVPLE 

      1630       1640       1650       1660       1670       1680 
PEMTTEVSPS QVSITEEEVG EEPVSTSHFS TSHLVSHTVF RCQLCKYFCS TRKGIARHYR 

      1690       1700       1710       1720       1730       1740 
IKHNNVRAQP EGKNNLFKCA LCAYTNPIRK GLAAHYQKRH DIDAYYTHCL AASRTISDKP 

      1750       1760       1770       1780       1790       1800 
NKVIIPSPPK DDSPQLSEEL RRAVEKKKCS LCSFQSFSKK GIVSHYMKRH PGVFPKKQHA 

      1810       1820       1830       1840       1850       1860 
SKLGGYFTAV YADEHEKPTL MEEEERGNFE KAEVEGEAQE IEWLPFRCIK CFKLSFSTAE 

      1870       1880       1890       1900       1910       1920 
LLCMHYTDHH SRDLKRDFII LGNGPRLQNS TYQCKHCDSK LQSTAELTSH LNIHNEEFQK 

      1930       1940       1950       1960       1970       1980 
RAKRQERRKQ LLSKQKYADG AFADFKQERP FGHLEEVPKI KERKVVGYKC KFCVEVHPTL 

      1990       2000       2010       2020       2030       2040 
RAICNHLRKH VQYGNVPAVS AAVKGLRSHE RSHLALAMFT REDKYSCQYC SFVSAFRHNL 

      2050       2060       2070       2080       2090       2100 
DRHMQTHHGH HKPFRCKLCS FKSSYNSRLK THILKAHAGE HAYKCSWCSF STMTISQLKE 

      2110       2120       2130       2140       2150       2160 
HSLKVHGKAL TLPRPRIVSL LSSHSHHSSQ KATPAEEVED SNDSSYSEPP DVQQQLNHYQ 

      2170       2180       2190       2200       2210       2220 
SAALARNNSR VSPVPLSGAA AGTEQKTEAV LHCEFCEFSS GYIQSIRRHY RDKHGGKKLF 

      2230       2240       2250       2260       2270       2280 
KCKDCSFYTG FKSAFTMHVE AGHSAVPEEG PKDLRCPLCL YHTKYKRNMI DHIVLHREER 

      2290       2300       2310       2320       2330       2340 
VVPIEVCRSK LSKYLQGVVF RCDKCTFTCS SDESLQQHIE KHNELKPYKC QLCYYETKHT 

      2350       2360       2370       2380       2390       2400 
EELDSHLRDE HKVSRNFELV GRVNLDQLEQ MKEKMESSSS DDEDKEEEMN SKAEDRELMR 

      2410       2420       2430       2440       2450       2460 
FSDHGAALNT EKRFPCEFCG RAFSQGSEWE RHVLRHGMAL NDTKQVSREE IHPKEIMENS 

      2470       2480       2490       2500 
VKMPSIEEKE DDEAIGIDFS LKNETVAICV VTADKSLLEN AEAKKE 

« Hide

Isoform 2 [UniParc].

Checksum: 6C979F201AABC035
Show »

FASTA1,412161,530
Isoform 3 [UniParc].

Checksum: 7073E699016C8FCD
Show »

FASTA2,566291,117

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]"Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: SEQUENCE REVISION.
[3]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1118-2506 (ISOFORM 3).
Tissue: Placenta.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1576-2506 (ISOFORM 1).
Tissue: Liver.
[6]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-688, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[7]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-350; SER-354; SER-688; SER-1090; SER-1166; SER-2172 AND SER-2177, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[8]"Discovery of O-GlcNAc-6-phosphate modified proteins in large-scale phosphoproteomics data."
Hahne H., Kuster B.
Mol. Cell. Proteomics 11:1063-1069(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: GLYCOSYLATION AT SER-292 AND SER-309.
Tissue: Embryonic stem cell.
[9]"Solution structures of the C2H2 type zinc finger domain of human zinc finger protein 462."
RIKEN structural genomics initiative (RSGI)
Submitted (NOV-2005) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 1874-1948.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB058706 mRNA. Translation: BAB47432.2.
AL512593 Genomic DNA. Translation: CAI14941.1.
AK027866 mRNA. No translation available.
BC036884 mRNA. Translation: AAH36884.1. Different initiation.
CCDSCCDS35096.1. [Q96JM2-1]
RefSeqNP_067047.4. NM_021224.4. [Q96JM2-1]
XP_006717278.1. XM_006717215.1. [Q96JM2-3]
XP_006717279.1. XM_006717216.1. [Q96JM2-1]
UniGeneHs.370379.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
1X6FNMR-A1874-1948[»]
ProteinModelPortalQ96JM2.
SMRQ96JM2. Positions 83-184, 216-262, 566-618, 1871-1948, 1968-2101, 2189-2357, 2403-2436.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121829. 4 interactions.
DIPDIP-39340N.
IntActQ96JM2. 4 interactions.
STRING9606.ENSP00000277225.

PTM databases

PhosphoSiteQ96JM2.

Polymorphism databases

DMDM238054352.

Proteomic databases

MaxQBQ96JM2.
PaxDbQ96JM2.
PRIDEQ96JM2.

Protocols and materials databases

DNASU58499.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000277225; ENSP00000277225; ENSG00000148143. [Q96JM2-1]
ENST00000441147; ENSP00000397306; ENSG00000148143. [Q96JM2-2]
ENST00000457913; ENSP00000414570; ENSG00000148143. [Q96JM2-3]
GeneID58499.
KEGGhsa:58499.
UCSCuc004bcz.3. human. [Q96JM2-1]
uc004bda.3. human. [Q96JM2-3]

Organism-specific databases

CTD58499.
GeneCardsGC09P109626.
HGNCHGNC:21684. ZNF462.
HPAHPA022283.
neXtProtNX_Q96JM2.
PharmGKBPA134949139.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG325150.
HOGENOMHOG000049226.
HOVERGENHBG058189.
OMAMMRGAEG.
OrthoDBEOG779NWW.
PhylomeDBQ96JM2.
TreeFamTF325534.

Gene expression databases

ArrayExpressQ96JM2.
BgeeQ96JM2.
CleanExHS_ZNF462.
GenevestigatorQ96JM2.

Family and domain databases

InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 34 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSZNF462. human.
EvolutionaryTraceQ96JM2.
GenomeRNAi58499.
NextBio65000.
PROQ96JM2.

Entry information

Entry nameZN462_HUMAN
AccessionPrimary (citable) accession number: Q96JM2
Secondary accession number(s): Q5T0T4, Q8N408
Entry history
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 26, 2009
Last modified: July 9, 2014
This is version 109 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM