Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JM2

- ZN462_HUMAN

UniProt

Q96JM2 - ZN462_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 462

Gene

ZNF462

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri4 – 2724C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri108 – 13124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri162 – 18524C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri439 – 46224C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri470 – 49223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri600 – 62324C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri843 – 86624C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri886 – 90823C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri925 – 94824C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1030 – 105324C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1265 – 128824C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1470 – 149324C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1515 – 153824C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1577 – 160024C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1660 – 168324C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1697 – 172024C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1892 – 191423C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1968 – 199225C2H2-type 18; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2025 – 204824C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2054 – 207724C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2083 – 210624C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2191 – 221424C2H2-type 22PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2220 – 224324C2H2-type 23PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2254 – 227623C2H2-type 24PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2300 – 232223C2H2-type 25PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2328 – 235124C2H2-type 26PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2414 – 243623C2H2-type 27PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. chromatin organization Source: Ensembl
  2. negative regulation of DNA binding Source: Ensembl
  3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  4. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 462
Gene namesi
Name:ZNF462
Synonyms:KIAA1803
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:21684. ZNF462.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134949139.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 25062506Zinc finger protein 462PRO_0000047601Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi292 – 2921O-linked (GlcNAc6P)1 Publication
Glycosylationi309 – 3091O-linked (GlcNAc6P)1 Publication
Modified residuei350 – 3501Phosphoserine1 Publication
Modified residuei354 – 3541Phosphoserine1 Publication
Modified residuei688 – 6881Phosphoserine2 Publications
Modified residuei1090 – 10901Phosphoserine1 Publication
Modified residuei1166 – 11661Phosphoserine1 Publication
Modified residuei2172 – 21721Phosphoserine1 Publication
Modified residuei2177 – 21771Phosphoserine1 Publication

Post-translational modificationi

O-GlcNAcylated with O-GlcNAc-6-phosphate.

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96JM2.
PaxDbiQ96JM2.
PRIDEiQ96JM2.

PTM databases

PhosphoSiteiQ96JM2.

Expressioni

Gene expression databases

BgeeiQ96JM2.
CleanExiHS_ZNF462.
ExpressionAtlasiQ96JM2. baseline and differential.
GenevestigatoriQ96JM2.

Organism-specific databases

HPAiHPA022283.

Interactioni

Protein-protein interaction databases

BioGridi121829. 4 interactions.
DIPiDIP-39340N.
IntActiQ96JM2. 4 interactions.
STRINGi9606.ENSP00000277225.

Structurei

Secondary structure

1
2506
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi1895 – 18973
Beta strandi1900 – 19034
Helixi1904 – 192118
Beta strandi1941 – 19433

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1X6FNMR-A1874-1948[»]
ProteinModelPortaliQ96JM2.
SMRiQ96JM2. Positions 1871-1948.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96JM2.

Family & Domainsi

Sequence similaritiesi

Contains 27 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri4 – 2724C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri108 – 13124C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri162 – 18524C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri439 – 46224C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri470 – 49223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri600 – 62324C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri843 – 86624C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri886 – 90823C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri925 – 94824C2H2-type 9PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1030 – 105324C2H2-type 10PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1265 – 128824C2H2-type 11PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1470 – 149324C2H2-type 12PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1515 – 153824C2H2-type 13PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1577 – 160024C2H2-type 14PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1660 – 168324C2H2-type 15PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1697 – 172024C2H2-type 16PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1892 – 191423C2H2-type 17PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri1968 – 199225C2H2-type 18; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2025 – 204824C2H2-type 19PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2054 – 207724C2H2-type 20PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2083 – 210624C2H2-type 21PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2191 – 221424C2H2-type 22PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2220 – 224324C2H2-type 23PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2254 – 227623C2H2-type 24PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2300 – 232223C2H2-type 25PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2328 – 235124C2H2-type 26PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri2414 – 243623C2H2-type 27PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG325150.
GeneTreeiENSGT00700000104378.
HOGENOMiHOG000049226.
HOVERGENiHBG058189.
InParanoidiQ96JM2.
OMAiMMRGAEG.
OrthoDBiEOG779NWW.
PhylomeDBiQ96JM2.
TreeFamiTF325534.

Family and domain databases

InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 34 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JM2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVLQCDGCD FRAPSYEDLK AHIQDVHTAF LQPTDVAEDN VNELRCGSVN
60 70 80 90 100
ASNQTEVEFS SIKDEFAIAE DLSGQNATSL GTGGYYGHSP GYYGQHIAAN
110 120 130 140 150
PKPTNKFFQC KFCVRYFRSK NLLIEHTRKV HGAQAEGSSS GPPVPGSLNY
160 170 180 190 200
NIMMHEGFGK VFSCQFCTYK SPRRARIIKH QKMYHKNNLK ETTAPPPAPA
210 220 230 240 250
PMPDPVVPPV SLQDPCKELP AEVVERSILE SMVKPLTKSR GNFCCEWCSY
260 270 280 290 300
QTPRRERWCD HMMKKHRSMV KILSSLRQQQ EGTNLPDVPN KSAPSPTSNS
310 320 330 340 350
TYLTMNAASR EIPNTTVSNF RGSMGNSIMR PNSSASKFSP MSYPQMKPKS
360 370 380 390 400
PHNSGLVNLT ERSRYGMTDM TNSSADLETN SMLNDSSSDE ELNEIDSENG
410 420 430 440 450
LSAMDHQTSG LSAEQLMGSD GNKLLETKGI PFRRFMNRFQ CPFCPFLTMH
460 470 480 490 500
RRSISRHIEN IHLSGKTAVY KCDECPFTCK SSLKLGAHKQ CHTGTTSDWD
510 520 530 540 550
AVNSQSESIS SSLNEGVVSY ESSSINGRKS GVMLDPLQQQ QPPQPPPPPP
560 570 580 590 600
PPPPSQPQPL QQPQPPQLQP PHQVPPQPQT QPPPTQQPQP PTQAAPLHPY
610 620 630 640 650
KCTMCNYSTT TLKGLRVHQQ HKHSFCDNLP KFEGQPSSLP LENETDSHPS
660 670 680 690 700
SSNTVKKSQT SILGLSSKNN FVAKASRKLA NDFPLDLSPV KKRTRIDEIA
710 720 730 740 750
SNLQSKINQT KQQEDAVINV EDDEEEEEDN EVEIEVELDR EEEPTEPIIE
760 770 780 790 800
VPTSFSAQQI WVRDTSEPQK EPNFRNITHD YNATNGAEIE LTLSEDEEDY
810 820 830 840 850
YGSSTNLKDH QVSNTALLNT QTPIYGTEHN SENTDFGDSG RLYYCKHCDF
860 870 880 890 900
NNKSARSVST HYQRMHPYIK FSFRYILDPN DHSAVYRCLE CYIDYTNFED
910 920 930 940 950
LQQHYGEHHP EAMNVLNFDH SDLIYRCRFC SYTSPNVRSL MPHYQRMHPT
960 970 980 990 1000
VKINNAMIFS SYVVEQQEGL NTESQTLREI LNSAPKNMAT STPVARGGGL
1010 1020 1030 1040 1050
PATFNKNTPK TFTPECENQK DPLVNTVVVY DCDVCSFASP NMHSVLVHYQ
1060 1070 1080 1090 1100
KKHPEEKASY FRIQKTMRMV SVDRGSALSQ LSFEVGAPMS PKMSNMGSPP
1110 1120 1130 1140 1150
PPQPPPPDLS TELYYCKHCS YSNRSVVGVL VHYQKRHPEI KVTAKYIRQA
1160 1170 1180 1190 1200
PPTAAMMRGV EGPQGSPRPP APIQQLNRSS SERDGPPVEN EMFFCQHCDY
1210 1220 1230 1240 1250
GNRTVKGVLI HYQKKHRDFK ANADVIRQHT ATIRSLCDRN QKKPASCVLV
1260 1270 1280 1290 1300
SPSNLERDKT KLRALKCRQC SYTSPYFYAL RKHIKKDHPA LKATVTSIMR
1310 1320 1330 1340 1350
WAFLDGLIEA GYHCEWCIYS HTEPNGLLLH YQRRHPEHYV DYTYMATKLW
1360 1370 1380 1390 1400
AGPDPSPPSL TMPAEAKTYR CRDCVFEAVS IWDITNHYQA FHPWAMNGDE
1410 1420 1430 1440 1450
SVLLDIIKEK DAVEKPILSS EELAGPVNCE NSIPTPFPEQ EAECPEDARL
1460 1470 1480 1490 1500
SPEKSLQLAS ANPAISSTPY QCTVCQSEYN NLHGLLTHYG KKHPGMKVKA
1510 1520 1530 1540 1550
ADFAQDIDIN PGAVYKCRHC PYINTRIHGV LTHYQKRHPS IKVTAEDFVH
1560 1570 1580 1590 1600
DVEQSADISQ NDVEETSRIF KQGYGAYRCK LCPYTHGTLE KLKIHYEKYH
1610 1620 1630 1640 1650
NQPEFDVFSQ SPPKLPVPLE PEMTTEVSPS QVSITEEEVG EEPVSTSHFS
1660 1670 1680 1690 1700
TSHLVSHTVF RCQLCKYFCS TRKGIARHYR IKHNNVRAQP EGKNNLFKCA
1710 1720 1730 1740 1750
LCAYTNPIRK GLAAHYQKRH DIDAYYTHCL AASRTISDKP NKVIIPSPPK
1760 1770 1780 1790 1800
DDSPQLSEEL RRAVEKKKCS LCSFQSFSKK GIVSHYMKRH PGVFPKKQHA
1810 1820 1830 1840 1850
SKLGGYFTAV YADEHEKPTL MEEEERGNFE KAEVEGEAQE IEWLPFRCIK
1860 1870 1880 1890 1900
CFKLSFSTAE LLCMHYTDHH SRDLKRDFII LGNGPRLQNS TYQCKHCDSK
1910 1920 1930 1940 1950
LQSTAELTSH LNIHNEEFQK RAKRQERRKQ LLSKQKYADG AFADFKQERP
1960 1970 1980 1990 2000
FGHLEEVPKI KERKVVGYKC KFCVEVHPTL RAICNHLRKH VQYGNVPAVS
2010 2020 2030 2040 2050
AAVKGLRSHE RSHLALAMFT REDKYSCQYC SFVSAFRHNL DRHMQTHHGH
2060 2070 2080 2090 2100
HKPFRCKLCS FKSSYNSRLK THILKAHAGE HAYKCSWCSF STMTISQLKE
2110 2120 2130 2140 2150
HSLKVHGKAL TLPRPRIVSL LSSHSHHSSQ KATPAEEVED SNDSSYSEPP
2160 2170 2180 2190 2200
DVQQQLNHYQ SAALARNNSR VSPVPLSGAA AGTEQKTEAV LHCEFCEFSS
2210 2220 2230 2240 2250
GYIQSIRRHY RDKHGGKKLF KCKDCSFYTG FKSAFTMHVE AGHSAVPEEG
2260 2270 2280 2290 2300
PKDLRCPLCL YHTKYKRNMI DHIVLHREER VVPIEVCRSK LSKYLQGVVF
2310 2320 2330 2340 2350
RCDKCTFTCS SDESLQQHIE KHNELKPYKC QLCYYETKHT EELDSHLRDE
2360 2370 2380 2390 2400
HKVSRNFELV GRVNLDQLEQ MKEKMESSSS DDEDKEEEMN SKAEDRELMR
2410 2420 2430 2440 2450
FSDHGAALNT EKRFPCEFCG RAFSQGSEWE RHVLRHGMAL NDTKQVSREE
2460 2470 2480 2490 2500
IHPKEIMENS VKMPSIEEKE DDEAIGIDFS LKNETVAICV VTADKSLLEN

AEAKKE
Length:2,506
Mass (Da):284,688
Last modified:May 26, 2009 - v3
Checksum:iBE921753A66384DB
GO
Isoform 2 (identifier: Q96JM2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1155: Missing.
     2004-2004: K → KQEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

Note: No experimental confirmation available.

Show »
Length:1,412
Mass (Da):161,530
Checksum:i6C979F201AABC035
GO
Isoform 3 (identifier: Q96JM2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     2004-2004: K → KEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

Show »
Length:2,566
Mass (Da):291,117
Checksum:i7073E699016C8FCD
GO

Sequence cautioni

The sequence AAH36884.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1241 – 12411Q → R in AK027866. (PubMed:14702039)Curated
Sequence conflicti1250 – 12501V → I in AK027866. (PubMed:14702039)Curated
Sequence conflicti1332 – 13321Q → R in AK027866. (PubMed:14702039)Curated
Sequence conflicti1424 – 14241A → T in AK027866. (PubMed:14702039)Curated
Sequence conflicti1430 – 14301E → A in AK027866. (PubMed:14702039)Curated
Sequence conflicti1936 – 19361K → E in AK027866. (PubMed:14702039)Curated
Sequence conflicti2030 – 20301C → S in AK027866. (PubMed:14702039)Curated
Sequence conflicti2277 – 22771Missing in AK027866. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti404 – 4041M → V.
Corresponds to variant rs17723637 [ dbSNP | Ensembl ].
VAR_058301
Natural varianti1187 – 11871P → S.
Corresponds to variant rs3814541 [ dbSNP | Ensembl ].
VAR_058302
Natural varianti1828 – 18281N → S.
Corresponds to variant rs3814538 [ dbSNP | Ensembl ].
VAR_058303
Natural varianti2052 – 20521K → R.
Corresponds to variant rs7020769 [ dbSNP | Ensembl ].
VAR_058304
Natural varianti2452 – 24521H → L.
Corresponds to variant rs10217192 [ dbSNP | Ensembl ].
VAR_058305

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11551155Missing in isoform 2. 1 PublicationVSP_037407Add
BLAST
Alternative sequencei2004 – 20041K → KQEADDPAHLFLDGLEAAKD ASGALVGRVDGEHCLLDGML EDETRPGGYHCSQCDRVLMS MQ in isoform 2. 1 PublicationVSP_037408
Alternative sequencei2004 – 20041K → KEADDPAHLFLDGLEAAKDA SGALVGRVDGEHCLLDGMLE DETRPGGYHCSQCDRVLMSM Q in isoform 3. 1 PublicationVSP_037409

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB058706 mRNA. Translation: BAB47432.2.
AL512593 Genomic DNA. Translation: CAI14941.1.
AK027866 mRNA. No translation available.
BC036884 mRNA. Translation: AAH36884.1. Different initiation.
CCDSiCCDS35096.1. [Q96JM2-1]
RefSeqiNP_067047.4. NM_021224.4. [Q96JM2-1]
XP_006717278.1. XM_006717215.1. [Q96JM2-3]
XP_006717279.1. XM_006717216.1. [Q96JM2-1]
UniGeneiHs.370379.

Genome annotation databases

EnsembliENST00000277225; ENSP00000277225; ENSG00000148143. [Q96JM2-1]
ENST00000441147; ENSP00000397306; ENSG00000148143. [Q96JM2-2]
GeneIDi58499.
KEGGihsa:58499.
UCSCiuc004bcz.3. human. [Q96JM2-1]
uc004bda.3. human. [Q96JM2-3]

Polymorphism databases

DMDMi238054352.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB058706 mRNA. Translation: BAB47432.2 .
AL512593 Genomic DNA. Translation: CAI14941.1 .
AK027866 mRNA. No translation available.
BC036884 mRNA. Translation: AAH36884.1 . Different initiation.
CCDSi CCDS35096.1. [Q96JM2-1 ]
RefSeqi NP_067047.4. NM_021224.4. [Q96JM2-1 ]
XP_006717278.1. XM_006717215.1. [Q96JM2-3 ]
XP_006717279.1. XM_006717216.1. [Q96JM2-1 ]
UniGenei Hs.370379.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1X6F NMR - A 1874-1948 [» ]
ProteinModelPortali Q96JM2.
SMRi Q96JM2. Positions 1871-1948.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121829. 4 interactions.
DIPi DIP-39340N.
IntActi Q96JM2. 4 interactions.
STRINGi 9606.ENSP00000277225.

PTM databases

PhosphoSitei Q96JM2.

Polymorphism databases

DMDMi 238054352.

Proteomic databases

MaxQBi Q96JM2.
PaxDbi Q96JM2.
PRIDEi Q96JM2.

Protocols and materials databases

DNASUi 58499.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000277225 ; ENSP00000277225 ; ENSG00000148143 . [Q96JM2-1 ]
ENST00000441147 ; ENSP00000397306 ; ENSG00000148143 . [Q96JM2-2 ]
GeneIDi 58499.
KEGGi hsa:58499.
UCSCi uc004bcz.3. human. [Q96JM2-1 ]
uc004bda.3. human. [Q96JM2-3 ]

Organism-specific databases

CTDi 58499.
GeneCardsi GC09P109626.
HGNCi HGNC:21684. ZNF462.
HPAi HPA022283.
neXtProti NX_Q96JM2.
PharmGKBi PA134949139.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG325150.
GeneTreei ENSGT00700000104378.
HOGENOMi HOG000049226.
HOVERGENi HBG058189.
InParanoidi Q96JM2.
OMAi MMRGAEG.
OrthoDBi EOG779NWW.
PhylomeDBi Q96JM2.
TreeFami TF325534.

Miscellaneous databases

ChiTaRSi ZNF462. human.
EvolutionaryTracei Q96JM2.
GenomeRNAii 58499.
NextBioi 65000.
PROi Q96JM2.

Gene expression databases

Bgeei Q96JM2.
CleanExi HS_ZNF462.
ExpressionAtlasi Q96JM2. baseline and differential.
Genevestigatori Q96JM2.

Family and domain databases

InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 34 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 9 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1118-2506 (ISOFORM 3).
    Tissue: Placenta.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1576-2506 (ISOFORM 1).
    Tissue: Liver.
  6. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-688, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-350; SER-354; SER-688; SER-1090; SER-1166; SER-2172 AND SER-2177, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Discovery of O-GlcNAc-6-phosphate modified proteins in large-scale phosphoproteomics data."
    Hahne H., Kuster B.
    Mol. Cell. Proteomics 11:1063-1069(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT SER-292 AND SER-309.
    Tissue: Embryonic stem cell.
  9. "Solution structures of the C2H2 type zinc finger domain of human zinc finger protein 462."
    RIKEN structural genomics initiative (RSGI)
    Submitted (NOV-2005) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 1874-1948.

Entry informationi

Entry nameiZN462_HUMAN
AccessioniPrimary (citable) accession number: Q96JM2
Secondary accession number(s): Q5T0T4, Q8N408
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: May 26, 2009
Last modified: October 29, 2014
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3