Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JM2

- ZN462_HUMAN

UniProt

Q96JM2 - ZN462_HUMAN

Protein

Zinc finger protein 462

Gene

ZNF462

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 3 (26 May 2009)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri4 – 2724C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri108 – 13124C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri162 – 18524C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri439 – 46224C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri470 – 49223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri600 – 62324C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri843 – 86624C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri886 – 90823C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri925 – 94824C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1030 – 105324C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1265 – 128824C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1470 – 149324C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1515 – 153824C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1577 – 160024C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1660 – 168324C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1697 – 172024C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1892 – 191423C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1968 – 199225C2H2-type 18; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2025 – 204824C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2054 – 207724C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2083 – 210624C2H2-type 21PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2191 – 221424C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2220 – 224324C2H2-type 23PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2254 – 227623C2H2-type 24PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2300 – 232223C2H2-type 25PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2328 – 235124C2H2-type 26PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2414 – 243623C2H2-type 27PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. chromatin organization Source: Ensembl
    2. negative regulation of DNA binding Source: Ensembl
    3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    4. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 462
    Gene namesi
    Name:ZNF462
    Synonyms:KIAA1803
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:21684. ZNF462.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134949139.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 25062506Zinc finger protein 462PRO_0000047601Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi292 – 2921O-linked (GlcNAc6P)1 Publication
    Glycosylationi309 – 3091O-linked (GlcNAc6P)1 Publication
    Modified residuei350 – 3501Phosphoserine1 Publication
    Modified residuei354 – 3541Phosphoserine1 Publication
    Modified residuei688 – 6881Phosphoserine2 Publications
    Modified residuei1090 – 10901Phosphoserine1 Publication
    Modified residuei1166 – 11661Phosphoserine1 Publication
    Modified residuei2172 – 21721Phosphoserine1 Publication
    Modified residuei2177 – 21771Phosphoserine1 Publication

    Post-translational modificationi

    O-GlcNAcylated with O-GlcNAc-6-phosphate.

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ96JM2.
    PaxDbiQ96JM2.
    PRIDEiQ96JM2.

    PTM databases

    PhosphoSiteiQ96JM2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96JM2.
    BgeeiQ96JM2.
    CleanExiHS_ZNF462.
    GenevestigatoriQ96JM2.

    Organism-specific databases

    HPAiHPA022283.

    Interactioni

    Protein-protein interaction databases

    BioGridi121829. 4 interactions.
    DIPiDIP-39340N.
    IntActiQ96JM2. 4 interactions.
    STRINGi9606.ENSP00000277225.

    Structurei

    Secondary structure

    1
    2506
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi1895 – 18973
    Beta strandi1900 – 19034
    Helixi1904 – 192118
    Beta strandi1941 – 19433

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1X6FNMR-A1874-1948[»]
    ProteinModelPortaliQ96JM2.
    SMRiQ96JM2. Positions 83-184, 216-262, 566-618, 1871-1948, 1968-2101, 2189-2357, 2403-2436.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96JM2.

    Family & Domainsi

    Sequence similaritiesi

    Contains 27 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri4 – 2724C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri108 – 13124C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri162 – 18524C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri439 – 46224C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri470 – 49223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri600 – 62324C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri843 – 86624C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri886 – 90823C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri925 – 94824C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1030 – 105324C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1265 – 128824C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1470 – 149324C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1515 – 153824C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1577 – 160024C2H2-type 14PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1660 – 168324C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1697 – 172024C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1892 – 191423C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1968 – 199225C2H2-type 18; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2025 – 204824C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2054 – 207724C2H2-type 20PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2083 – 210624C2H2-type 21PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2191 – 221424C2H2-type 22PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2220 – 224324C2H2-type 23PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2254 – 227623C2H2-type 24PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2300 – 232223C2H2-type 25PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2328 – 235124C2H2-type 26PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri2414 – 243623C2H2-type 27PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG325150.
    HOGENOMiHOG000049226.
    HOVERGENiHBG058189.
    OMAiMMRGAEG.
    OrthoDBiEOG779NWW.
    PhylomeDBiQ96JM2.
    TreeFamiTF325534.

    Family and domain databases

    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 34 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 9 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JM2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEVLQCDGCD FRAPSYEDLK AHIQDVHTAF LQPTDVAEDN VNELRCGSVN     50
    ASNQTEVEFS SIKDEFAIAE DLSGQNATSL GTGGYYGHSP GYYGQHIAAN 100
    PKPTNKFFQC KFCVRYFRSK NLLIEHTRKV HGAQAEGSSS GPPVPGSLNY 150
    NIMMHEGFGK VFSCQFCTYK SPRRARIIKH QKMYHKNNLK ETTAPPPAPA 200
    PMPDPVVPPV SLQDPCKELP AEVVERSILE SMVKPLTKSR GNFCCEWCSY 250
    QTPRRERWCD HMMKKHRSMV KILSSLRQQQ EGTNLPDVPN KSAPSPTSNS 300
    TYLTMNAASR EIPNTTVSNF RGSMGNSIMR PNSSASKFSP MSYPQMKPKS 350
    PHNSGLVNLT ERSRYGMTDM TNSSADLETN SMLNDSSSDE ELNEIDSENG 400
    LSAMDHQTSG LSAEQLMGSD GNKLLETKGI PFRRFMNRFQ CPFCPFLTMH 450
    RRSISRHIEN IHLSGKTAVY KCDECPFTCK SSLKLGAHKQ CHTGTTSDWD 500
    AVNSQSESIS SSLNEGVVSY ESSSINGRKS GVMLDPLQQQ QPPQPPPPPP 550
    PPPPSQPQPL QQPQPPQLQP PHQVPPQPQT QPPPTQQPQP PTQAAPLHPY 600
    KCTMCNYSTT TLKGLRVHQQ HKHSFCDNLP KFEGQPSSLP LENETDSHPS 650
    SSNTVKKSQT SILGLSSKNN FVAKASRKLA NDFPLDLSPV KKRTRIDEIA 700
    SNLQSKINQT KQQEDAVINV EDDEEEEEDN EVEIEVELDR EEEPTEPIIE 750
    VPTSFSAQQI WVRDTSEPQK EPNFRNITHD YNATNGAEIE LTLSEDEEDY 800
    YGSSTNLKDH QVSNTALLNT QTPIYGTEHN SENTDFGDSG RLYYCKHCDF 850
    NNKSARSVST HYQRMHPYIK FSFRYILDPN DHSAVYRCLE CYIDYTNFED 900
    LQQHYGEHHP EAMNVLNFDH SDLIYRCRFC SYTSPNVRSL MPHYQRMHPT 950
    VKINNAMIFS SYVVEQQEGL NTESQTLREI LNSAPKNMAT STPVARGGGL 1000
    PATFNKNTPK TFTPECENQK DPLVNTVVVY DCDVCSFASP NMHSVLVHYQ 1050
    KKHPEEKASY FRIQKTMRMV SVDRGSALSQ LSFEVGAPMS PKMSNMGSPP 1100
    PPQPPPPDLS TELYYCKHCS YSNRSVVGVL VHYQKRHPEI KVTAKYIRQA 1150
    PPTAAMMRGV EGPQGSPRPP APIQQLNRSS SERDGPPVEN EMFFCQHCDY 1200
    GNRTVKGVLI HYQKKHRDFK ANADVIRQHT ATIRSLCDRN QKKPASCVLV 1250
    SPSNLERDKT KLRALKCRQC SYTSPYFYAL RKHIKKDHPA LKATVTSIMR 1300
    WAFLDGLIEA GYHCEWCIYS HTEPNGLLLH YQRRHPEHYV DYTYMATKLW 1350
    AGPDPSPPSL TMPAEAKTYR CRDCVFEAVS IWDITNHYQA FHPWAMNGDE 1400
    SVLLDIIKEK DAVEKPILSS EELAGPVNCE NSIPTPFPEQ EAECPEDARL 1450
    SPEKSLQLAS ANPAISSTPY QCTVCQSEYN NLHGLLTHYG KKHPGMKVKA 1500
    ADFAQDIDIN PGAVYKCRHC PYINTRIHGV LTHYQKRHPS IKVTAEDFVH 1550
    DVEQSADISQ NDVEETSRIF KQGYGAYRCK LCPYTHGTLE KLKIHYEKYH 1600
    NQPEFDVFSQ SPPKLPVPLE PEMTTEVSPS QVSITEEEVG EEPVSTSHFS 1650
    TSHLVSHTVF RCQLCKYFCS TRKGIARHYR IKHNNVRAQP EGKNNLFKCA 1700
    LCAYTNPIRK GLAAHYQKRH DIDAYYTHCL AASRTISDKP NKVIIPSPPK 1750
    DDSPQLSEEL RRAVEKKKCS LCSFQSFSKK GIVSHYMKRH PGVFPKKQHA 1800
    SKLGGYFTAV YADEHEKPTL MEEEERGNFE KAEVEGEAQE IEWLPFRCIK 1850
    CFKLSFSTAE LLCMHYTDHH SRDLKRDFII LGNGPRLQNS TYQCKHCDSK 1900
    LQSTAELTSH LNIHNEEFQK RAKRQERRKQ LLSKQKYADG AFADFKQERP 1950
    FGHLEEVPKI KERKVVGYKC KFCVEVHPTL RAICNHLRKH VQYGNVPAVS 2000
    AAVKGLRSHE RSHLALAMFT REDKYSCQYC SFVSAFRHNL DRHMQTHHGH 2050
    HKPFRCKLCS FKSSYNSRLK THILKAHAGE HAYKCSWCSF STMTISQLKE 2100
    HSLKVHGKAL TLPRPRIVSL LSSHSHHSSQ KATPAEEVED SNDSSYSEPP 2150
    DVQQQLNHYQ SAALARNNSR VSPVPLSGAA AGTEQKTEAV LHCEFCEFSS 2200
    GYIQSIRRHY RDKHGGKKLF KCKDCSFYTG FKSAFTMHVE AGHSAVPEEG 2250
    PKDLRCPLCL YHTKYKRNMI DHIVLHREER VVPIEVCRSK LSKYLQGVVF 2300
    RCDKCTFTCS SDESLQQHIE KHNELKPYKC QLCYYETKHT EELDSHLRDE 2350
    HKVSRNFELV GRVNLDQLEQ MKEKMESSSS DDEDKEEEMN SKAEDRELMR 2400
    FSDHGAALNT EKRFPCEFCG RAFSQGSEWE RHVLRHGMAL NDTKQVSREE 2450
    IHPKEIMENS VKMPSIEEKE DDEAIGIDFS LKNETVAICV VTADKSLLEN 2500
    AEAKKE 2506
    Length:2,506
    Mass (Da):284,688
    Last modified:May 26, 2009 - v3
    Checksum:iBE921753A66384DB
    GO
    Isoform 2 (identifier: Q96JM2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1155: Missing.
         2004-2004: K → KQEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

    Note: No experimental confirmation available.

    Show »
    Length:1,412
    Mass (Da):161,530
    Checksum:i6C979F201AABC035
    GO
    Isoform 3 (identifier: Q96JM2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         2004-2004: K → KEADDPAHLFLDGLEAAKDASGALVGRVDGEHCLLDGMLEDETRPGGYHCSQCDRVLMSMQ

    Show »
    Length:2,566
    Mass (Da):291,117
    Checksum:i7073E699016C8FCD
    GO

    Sequence cautioni

    The sequence AAH36884.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1241 – 12411Q → R in AK027866. (PubMed:14702039)Curated
    Sequence conflicti1250 – 12501V → I in AK027866. (PubMed:14702039)Curated
    Sequence conflicti1332 – 13321Q → R in AK027866. (PubMed:14702039)Curated
    Sequence conflicti1424 – 14241A → T in AK027866. (PubMed:14702039)Curated
    Sequence conflicti1430 – 14301E → A in AK027866. (PubMed:14702039)Curated
    Sequence conflicti1936 – 19361K → E in AK027866. (PubMed:14702039)Curated
    Sequence conflicti2030 – 20301C → S in AK027866. (PubMed:14702039)Curated
    Sequence conflicti2277 – 22771Missing in AK027866. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti404 – 4041M → V.
    Corresponds to variant rs17723637 [ dbSNP | Ensembl ].
    VAR_058301
    Natural varianti1187 – 11871P → S.
    Corresponds to variant rs3814541 [ dbSNP | Ensembl ].
    VAR_058302
    Natural varianti1828 – 18281N → S.
    Corresponds to variant rs3814538 [ dbSNP | Ensembl ].
    VAR_058303
    Natural varianti2052 – 20521K → R.
    Corresponds to variant rs7020769 [ dbSNP | Ensembl ].
    VAR_058304
    Natural varianti2452 – 24521H → L.
    Corresponds to variant rs10217192 [ dbSNP | Ensembl ].
    VAR_058305

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11551155Missing in isoform 2. 1 PublicationVSP_037407Add
    BLAST
    Alternative sequencei2004 – 20041K → KQEADDPAHLFLDGLEAAKD ASGALVGRVDGEHCLLDGML EDETRPGGYHCSQCDRVLMS MQ in isoform 2. 1 PublicationVSP_037408
    Alternative sequencei2004 – 20041K → KEADDPAHLFLDGLEAAKDA SGALVGRVDGEHCLLDGMLE DETRPGGYHCSQCDRVLMSM Q in isoform 3. 1 PublicationVSP_037409

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB058706 mRNA. Translation: BAB47432.2.
    AL512593 Genomic DNA. Translation: CAI14941.1.
    AK027866 mRNA. No translation available.
    BC036884 mRNA. Translation: AAH36884.1. Different initiation.
    CCDSiCCDS35096.1. [Q96JM2-1]
    RefSeqiNP_067047.4. NM_021224.4. [Q96JM2-1]
    XP_006717278.1. XM_006717215.1. [Q96JM2-3]
    XP_006717279.1. XM_006717216.1. [Q96JM2-1]
    UniGeneiHs.370379.

    Genome annotation databases

    EnsembliENST00000277225; ENSP00000277225; ENSG00000148143. [Q96JM2-1]
    ENST00000441147; ENSP00000397306; ENSG00000148143. [Q96JM2-2]
    GeneIDi58499.
    KEGGihsa:58499.
    UCSCiuc004bcz.3. human. [Q96JM2-1]
    uc004bda.3. human. [Q96JM2-3]

    Polymorphism databases

    DMDMi238054352.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB058706 mRNA. Translation: BAB47432.2 .
    AL512593 Genomic DNA. Translation: CAI14941.1 .
    AK027866 mRNA. No translation available.
    BC036884 mRNA. Translation: AAH36884.1 . Different initiation.
    CCDSi CCDS35096.1. [Q96JM2-1 ]
    RefSeqi NP_067047.4. NM_021224.4. [Q96JM2-1 ]
    XP_006717278.1. XM_006717215.1. [Q96JM2-3 ]
    XP_006717279.1. XM_006717216.1. [Q96JM2-1 ]
    UniGenei Hs.370379.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1X6F NMR - A 1874-1948 [» ]
    ProteinModelPortali Q96JM2.
    SMRi Q96JM2. Positions 83-184, 216-262, 566-618, 1871-1948, 1968-2101, 2189-2357, 2403-2436.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121829. 4 interactions.
    DIPi DIP-39340N.
    IntActi Q96JM2. 4 interactions.
    STRINGi 9606.ENSP00000277225.

    PTM databases

    PhosphoSitei Q96JM2.

    Polymorphism databases

    DMDMi 238054352.

    Proteomic databases

    MaxQBi Q96JM2.
    PaxDbi Q96JM2.
    PRIDEi Q96JM2.

    Protocols and materials databases

    DNASUi 58499.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000277225 ; ENSP00000277225 ; ENSG00000148143 . [Q96JM2-1 ]
    ENST00000441147 ; ENSP00000397306 ; ENSG00000148143 . [Q96JM2-2 ]
    GeneIDi 58499.
    KEGGi hsa:58499.
    UCSCi uc004bcz.3. human. [Q96JM2-1 ]
    uc004bda.3. human. [Q96JM2-3 ]

    Organism-specific databases

    CTDi 58499.
    GeneCardsi GC09P109626.
    HGNCi HGNC:21684. ZNF462.
    HPAi HPA022283.
    neXtProti NX_Q96JM2.
    PharmGKBi PA134949139.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG325150.
    HOGENOMi HOG000049226.
    HOVERGENi HBG058189.
    OMAi MMRGAEG.
    OrthoDBi EOG779NWW.
    PhylomeDBi Q96JM2.
    TreeFami TF325534.

    Miscellaneous databases

    ChiTaRSi ZNF462. human.
    EvolutionaryTracei Q96JM2.
    GenomeRNAii 58499.
    NextBioi 65000.
    PROi Q96JM2.

    Gene expression databases

    ArrayExpressi Q96JM2.
    Bgeei Q96JM2.
    CleanExi HS_ZNF462.
    Genevestigatori Q96JM2.

    Family and domain databases

    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 34 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 8 hits.
    PS50157. ZINC_FINGER_C2H2_2. 9 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
      DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    3. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1118-2506 (ISOFORM 3).
      Tissue: Placenta.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1576-2506 (ISOFORM 1).
      Tissue: Liver.
    6. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-688, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-350; SER-354; SER-688; SER-1090; SER-1166; SER-2172 AND SER-2177, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Discovery of O-GlcNAc-6-phosphate modified proteins in large-scale phosphoproteomics data."
      Hahne H., Kuster B.
      Mol. Cell. Proteomics 11:1063-1069(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: GLYCOSYLATION AT SER-292 AND SER-309.
      Tissue: Embryonic stem cell.
    9. "Solution structures of the C2H2 type zinc finger domain of human zinc finger protein 462."
      RIKEN structural genomics initiative (RSGI)
      Submitted (NOV-2005) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 1874-1948.

    Entry informationi

    Entry nameiZN462_HUMAN
    AccessioniPrimary (citable) accession number: Q96JM2
    Secondary accession number(s): Q5T0T4, Q8N408
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 2, 2004
    Last sequence update: May 26, 2009
    Last modified: October 1, 2014
    This is version 110 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3