Q96JK4 (HIPL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: HHIP-like protein 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 782 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the HHIP family. Contains 1 SRCR domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | carbohydrate metabolic process Inferred from electronic annotation. Source: InterPro |
| Cellular_component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell membraneInferred from electronic annotation. Source: InterPro |
| Molecular_function | oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor Inferred from electronic annotation. Source: InterPro quinone bindingInferred from electronic annotation. Source: InterPro scavenger receptor activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96JK4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96JK4-2) The sequence of this isoform differs from the canonical sequence as follows: 577-608: RRAPPGKCQIQPAQVKIRSRLIPFVPKEKFIP → SCKARSAMPGYVPAPSVCSSLTSQPFILQWWK 609-782: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Potential | ||||||||
| Chain | 20 – 782 | 763 | HHIP-like protein 1 | PRO_0000314962 | |||||||
Regions | |||||||||||
| Domain | 673 – 776 | 104 | SRCR | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 234 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 181 ↔ 521 | By similarity | |||||||||
| Disulfide bond | 185 ↔ 528 | By similarity | |||||||||
| Disulfide bond | 399 ↔ 417 | By similarity | |||||||||
| Disulfide bond | 484 ↔ 584 | By similarity | |||||||||
| Disulfide bond | 700 ↔ 765 | By similarity | |||||||||
| Disulfide bond | 713 ↔ 775 | By similarity | |||||||||
| Disulfide bond | 745 ↔ 755 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 577 – 608 | 32 | RRAPP…EKFIP → SCKARSAMPGYVPAPSVCSS LTSQPFILQWWK in isoform 2. | VSP_030455 | |||||||
| Alternative sequence | 609 – 782 | 174 | Missing in isoform 2. | VSP_030456 | |||||||
| Natural variant | 692 | 1 | V → A. Corresponds to variant rs7158073 [ dbSNP | Ensembl ]. | VAR_060163 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 151 | 1 | L → M in AAQ88540. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [2] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [4] | "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O. DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 250-782 (ISOFORM 1). Tissue: Brain. |
| [5] | "Comparative genomics on HHIP family orthologs." Katoh Y., Katoh M. Int. J. Mol. Med. 17:391-395(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, NOMENCLATURE. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358173 mRNA. Translation: AAQ88540.1. AL160313 Genomic DNA. No translation available. BC132877 mRNA. Translation: AAI32878.1. BC136577 mRNA. Translation: AAI36578.1. AB058725 mRNA. Translation: BAB47451.1. |
| IPI | IPI00477056. IPI00873374. |
| RefSeq | NP_001120730.1. NM_001127258.1. NP_115801.3. NM_032425.4. |
| UniGene | Hs.288522. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1BY2 based on UniProtKB Q08380. |
| ProteinModelPortal | Q96JK4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000330601. |
PTM databases | |
| PhosphoSite | Q96JK4. |
Polymorphism databases | |
| DMDM | 166218135. |
Proteomic databases | |
| PaxDb | Q96JK4. |
| PRIDE | Q96JK4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000330710; ENSP00000330601; ENSG00000182218. ENST00000357223; ENSP00000349757; ENSG00000182218. |
| GeneID | 84439. |
| KEGG | hsa:84439. |
| UCSC | uc001ygl.1. human. uc010avs.3. human. |
Organism-specific databases | |
| CTD | 84439. |
| GeneCards | GC14P100111. |
| H-InvDB | HIX0011961. HIX0172357. |
| HGNC | HGNC:19710. HHIPL1. |
| HPA | HPA047242. |
| neXtProt | NX_Q96JK4. |
| PharmGKB | PA162390893. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2133. |
| HOGENOM | HOG000244857. |
| HOVERGEN | HBG107978. |
| OMA | TDYCFPR. |
| OrthoDB | EOG4GHZNW. |
Gene expression databases | |
| ArrayExpress | Q96JK4. |
| Bgee | Q96JK4. |
| CleanEx | HS_HHIPL1. |
| Genevestigator | Q96JK4. |
Family and domain databases | |
| Gene3D | 2.120.10.30. 1 hit. |
| InterPro | IPR011042. 6-blade_b-propeller_TolB-like. IPR018143. Folate_rcpt-like. IPR012938. Glc/Sorbosone_DH. IPR011041. Quinoprot_gluc/sorb_DH. IPR001190. Srcr_rcpt. IPR017448. Srcr_rcpt-rel. [Graphical view] |
| Pfam | PF03024. Folate_rec. 1 hit. PF07995. GSDH. 1 hit. PF00530. SRCR. 1 hit. [Graphical view] |
| PRINTS | PR00258. SPERACTRCPTR. |
| SMART | SM00202. SR. 1 hit. [Graphical view] |
| SUPFAM | SSF50952. Quino_gluc_DH. 1 hit. SSF56487. Srcr_receptor. 1 hit. |
| PROSITE | PS00420. SRCR_1. 1 hit. PS50287. SRCR_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84439. |
| NextBio | 74187. |
Entry information
| Entry name | HIPL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96JK4 Secondary accession number(s): A2RUF8, B2RN09, Q6UXX2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
