Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96JK4 (HIPL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 89. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
HHIP-like protein 1
Gene names
Name:HHIPL1
Synonyms:HHIP2, KIAA1822
ORF Names:UNQ9245/PRO34761
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length782 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Secreted Potential.

Sequence similarities

Belongs to the HHIP family.

Contains 1 SRCR domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96JK4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96JK4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     577-608: RRAPPGKCQIQPAQVKIRSRLIPFVPKEKFIP → SCKARSAMPGYVPAPSVCSSLTSQPFILQWWK
     609-782: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Potential
Chain20 – 782763HHIP-like protein 1
PRO_0000314962

Regions

Domain673 – 776104SRCR

Amino acid modifications

Glycosylation2341N-linked (GlcNAc...) Potential
Disulfide bond181 ↔ 521 By similarity
Disulfide bond185 ↔ 528 By similarity
Disulfide bond399 ↔ 417 By similarity
Disulfide bond484 ↔ 584 By similarity
Disulfide bond700 ↔ 765 By similarity
Disulfide bond713 ↔ 775 By similarity
Disulfide bond745 ↔ 755 By similarity

Natural variations

Alternative sequence577 – 60832RRAPP…EKFIP → SCKARSAMPGYVPAPSVCSS LTSQPFILQWWK in isoform 2.
VSP_030455
Alternative sequence609 – 782174Missing in isoform 2.
VSP_030456
Natural variant6921V → A.
Corresponds to variant rs7158073 [ dbSNP | Ensembl ].
VAR_060163

Experimental info

Sequence conflict1511L → M in AAQ88540. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 15, 2008. Version 2.
Checksum: 5A6170845C6F9472

FASTA78286,731
        10         20         30         40         50         60 
MARARAGALL ALWVLGAAAH PQCLDFRPPF RPTQPLRLCA QYSDFGCCDE GRDAELTRRF 

        70         80         90        100        110        120 
WALASRVDAA EWAACAGYAR DLLCQECSPY AAHLYDAEDP FTPLRTVPGL CQDYCLDMWH 

       130        140        150        160        170        180 
KCRGLFRHLS TDQELWALEG NLARFCRYLS LDDTDYCFPY LLVNKNLNSN LGHVVADAKG 

       190        200        210        220        230        240 
CLQLCLEEVA NGLRNPVAMV HARDGTHRFF VAEQVGLVWA YLPDRSRLGK PFLNISRVVL 

       250        260        270        280        290        300 
TSPWEGDERG FLGIAFHPSF QHNRRLYVYY SVGIRSSEWI RISEFRVSED DENAVDHSSE 

       310        320        330        340        350        360 
RIILEVKEPA SNHNGGQLLF GDDGYLYIFT GDGGMAGDPF GTFGNAQNKS ALLGKVLRID 

       370        380        390        400        410        420 
VDRKERGLPY GIPPDNPFVG DPAAQPEVYA LGVRNMWRCS FDRGDPSSGT GRGRLFCGDV 

       430        440        450        460        470        480 
GQNKFEEVDV VERGGNYGWR AREGFECYDR SLCANTSLND LLPIFAYPHT VGKSVTGGYV 

       490        500        510        520        530        540 
YRGCEYPNLN GLYIFGDFMS GRLMSLQENP GTGQWQYSEI CMGHGQTCEF PGLINNYYPY 

       550        560        570        580        590        600 
IISFGEDEAG ELYFMSTGEP SATAPRGVVY KIIDASRRAP PGKCQIQPAQ VKIRSRLIPF 

       610        620        630        640        650        660 
VPKEKFIPKT RSTPRPTARA PTRAPRRGRP TAAPPAPTPR PARPTQQPGS RRGGGRRRGR 

       670        680        690        700        710        720 
LNSASRAFRD GEVRLVRPAG LSSGSGRVEV FVGGRWGTVC DDSWNISGAA VVCRQLGFAY 

       730        740        750        760        770        780 
AVRAVKRAEF GQGGSLPILL DDVRCAGWER NLLECQHNGV GTHNCEHDED AGVVCSHQNP 


DL 

« Hide

Isoform 2 [UniParc].

Checksum: 3FC5CDF759808D6B
Show »

FASTA60867,881

References

« Hide 'large scale' references
[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[2]"The DNA sequence and analysis of human chromosome 14."
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. expand/collapse author list , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[4]"Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 250-782 (ISOFORM 1).
Tissue: Brain.
[5]"Comparative genomics on HHIP family orthologs."
Katoh Y., Katoh M.
Int. J. Mol. Med. 17:391-395(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION, NOMENCLATURE.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY358173 mRNA. Translation: AAQ88540.1.
AL160313 Genomic DNA. No translation available.
BC132877 mRNA. Translation: AAI32878.1.
BC136577 mRNA. Translation: AAI36578.1.
AB058725 mRNA. Translation: BAB47451.1.
CCDSCCDS45162.1. [Q96JK4-1]
CCDS9953.1. [Q96JK4-2]
RefSeqNP_001120730.1. NM_001127258.1. [Q96JK4-1]
NP_115801.3. NM_032425.4. [Q96JK4-2]
UniGeneHs.288522.

3D structure databases

ProteinModelPortalQ96JK4.
SMRQ96JK4. Positions 184-590, 667-778.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000330601.

PTM databases

PhosphoSiteQ96JK4.

Polymorphism databases

DMDM166218135.

Proteomic databases

PaxDbQ96JK4.
PRIDEQ96JK4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000330710; ENSP00000330601; ENSG00000182218. [Q96JK4-1]
ENST00000357223; ENSP00000349757; ENSG00000182218. [Q96JK4-2]
GeneID84439.
KEGGhsa:84439.
UCSCuc001ygl.1. human. [Q96JK4-2]
uc010avs.3. human. [Q96JK4-1]

Organism-specific databases

CTD84439.
GeneCardsGC14P100111.
H-InvDBHIX0011961.
HIX0172357.
HGNCHGNC:19710. HHIPL1.
HPAHPA047242.
neXtProtNX_Q96JK4.
PharmGKBPA162390893.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2133.
HOGENOMHOG000244857.
HOVERGENHBG107978.
OMADHGSERI.
OrthoDBEOG7CZK54.
PhylomeDBQ96JK4.
TreeFamTF329059.

Gene expression databases

ArrayExpressQ96JK4.
BgeeQ96JK4.
CleanExHS_HHIPL1.
GenevestigatorQ96JK4.

Family and domain databases

Gene3D2.120.10.30. 1 hit.
3.10.250.10. 1 hit.
InterProIPR011042. 6-blade_b-propeller_TolB-like.
IPR018143. Folate_rcpt-like.
IPR012938. Glc/Sorbosone_DH.
IPR011041. Quinoprot_gluc/sorb_DH.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
[Graphical view]
PfamPF03024. Folate_rec. 1 hit.
PF07995. GSDH. 1 hit.
PF00530. SRCR. 1 hit.
[Graphical view]
PRINTSPR00258. SPERACTRCPTR.
SMARTSM00202. SR. 1 hit.
[Graphical view]
SUPFAMSSF50952. SSF50952. 1 hit.
SSF56487. SSF56487. 1 hit.
PROSITEPS00420. SRCR_1. 1 hit.
PS50287. SRCR_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi84439.
NextBio74187.
PROQ96JK4.

Entry information

Entry nameHIPL1_HUMAN
AccessionPrimary (citable) accession number: Q96JK4
Secondary accession number(s): A2RUF8, B2RN09, Q6UXX2
Entry history
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: July 9, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 14

Human chromosome 14: entries, gene names and cross-references to MIM