SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JE7

- SC16B_HUMAN

UniProt

Q96JE7 - SC16B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein transport protein Sec16B
Gene
SEC16B, KIAA1928, LZTR2, RGPR, SEC16S
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus and for normal transitional endoplasmic reticulum (tER) organization.1 Publication

GO - Biological processi

  1. COPII vesicle coating Source: InterPro
  2. endoplasmic reticulum organization Source: UniProtKB
  3. peroxisome fission Source: UniProtKB
  4. peroxisome organization Source: UniProtKB
  5. positive regulation of gene expression Source: UniProtKB
  6. positive regulation of protein exit from endoplasmic reticulum Source: UniProtKB
  7. protein localization to endoplasmic reticulum Source: UniProtKB
  8. protein transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

ER-Golgi transport, Protein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Protein transport protein Sec16B
Alternative name(s):
Leucine zipper transcription regulator 2
Regucalcin gene promoter region-related protein p117
Short name:
RGPR-p117
SEC16 homolog B
Gene namesi
Name:SEC16B
Synonyms:KIAA1928, LZTR2, RGPR, SEC16S
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:30301. SEC16B.

Subcellular locationi

Endoplasmic reticulum membrane; Peripheral membrane protein By similarity. Golgi apparatus membrane; Peripheral membrane protein By similarity 1 Publication

GO - Cellular componenti

  1. Golgi membrane Source: UniProtKB-SubCell
  2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  3. intracellular membrane-bounded organelle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162402680.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10601060Protein transport protein Sec16B
PRO_0000341974Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei188 – 1881Phosphoserine By similarity
Modified residuei871 – 8711Phosphoserine By similarity
Modified residuei874 – 8741Phosphoserine By similarity
Modified residuei882 – 8821Phosphoserine By similarity
Modified residuei883 – 8831Phosphoserine By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ96JE7.
PRIDEiQ96JE7.

PTM databases

PhosphoSiteiQ96JE7.

Expressioni

Tissue specificityi

Ubiquitous.2 Publications

Gene expression databases

ArrayExpressiQ96JE7.
BgeeiQ96JE7.
CleanExiHS_SEC16B.
GenevestigatoriQ96JE7.

Organism-specific databases

HPAiHPA031202.

Interactioni

Subunit structurei

SEC16A and SEC16B are each present in multiple copies in a heteromeric complex.1 Publication

Protein-protein interaction databases

BioGridi124624. 1 interaction.
IntActiQ96JE7. 1 interaction.
STRINGi9606.ENSP00000308339.

Structurei

3D structure databases

ProteinModelPortaliQ96JE7.
SMRiQ96JE7. Positions 324-657.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni34 – 224191Required for endoplasmic reticulum localization
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi88 – 12639Tyr-rich
Add
BLAST
Compositional biasi232 – 2354Poly-Ser

Sequence similaritiesi

Belongs to the SEC16 family.

Phylogenomic databases

eggNOGiNOG12793.
HOGENOMiHOG000049067.
HOVERGENiHBG108463.
OMAiATCCGDK.
OrthoDBiEOG7MH0XQ.
PhylomeDBiQ96JE7.

Family and domain databases

InterProiIPR024880. Sec16.
IPR024340. Sec16_CCD.
[Graphical view]
PANTHERiPTHR13402. PTHR13402. 1 hit.
PfamiPF12932. Sec16. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JE7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MELWAPQRLP QTRGKATAPS KDPDRGFRRD GHHRPVPHSW HNGERFHQWQ     50
DNRGSPQPQQ EPRADHQQQP HYASRPGDWH QPVSGVDYYE GGYRNQLYSR 100
PGYENSYQSY QSPTMREEYA YGSYYYHGHP QWLQEERVPR QRSPYIWHED 150
YREQKYLDEH HYENQHSPFG TNSETHFQSN SRNPCKDSPA SNSGQEWPGE 200
LFPGSLLAEA QKNKPSLASE SNLLQQRESG LSSSSYELSQ YIRDAPERDD 250
PPASAAWSPV QADVSSAGPK APMKFYIPHV PVSFGPGGQL VHVGPSSPTD 300
GQAALVELHS MEVILNDSEE QEEMRSFSGP LIREDVHKVD IMTFCQQKAA 350
QSCKSETLGS RDSALLWQLL VLLCRQNGSM VGSDIAELLM QDCKKLEKYK 400
RQPPVANLIN LTDEDWPVLS SGTPNLLTGE IPPSVETPAQ IVEKFTRLLY 450
YGRKKEALEW AMKNHLWGHA LFLSSKMDPQ TYSWVMSGFT STLALNDPLQ 500
TLFQLMSGRI PQAATCCGEK QWGDWRPHLA VILSNQAGDP ELYQRAIVAI 550
GDTLAGKGLV EAAHFCYLMA HVPFGHYTVK TDHLVLLGSS HSQEFLKFAT 600
TEAIQRTEIF EYCQMLGRPK SFIPSFQVYK LLYASRLADY GLVSQALHYC 650
EAIGAAVLSQ GESSHPVLLV ELIKLAEKLK LSDPLVLERR SGDRDLEPDW 700
LAQLRRQLEQ KVAGDIGDPH PTRSDISGAG GTTTENTFYQ DFSGCQGYSE 750
APGYRSALWL TPEQTCLLQP SPQQPFPLQP GSYPAGGGAG QTGTPRPFYS 800
VPETHLPGTG SSVAVTEATG GTVWEEMLQT HLGPGENTVS QETSQPPDGQ 850
EVISKPQTPL AARPRSISES SASSAKEDEK ESSDEADKNS PRNTAQRGKL 900
GDGKEHTKSS GFGWFSWFRS KPTKNASPAG DEDSSDSPDS EETPRASSPH 950
QAGLGLSLTP SPESPPLPDV SAFSRGRGGG EGRGSASSGG AAAGAGVGGL 1000
SGPESVSFEL CSNPGVLLPP PALKGAVPLY NPSQVPQLPT ATSLNRPNRL 1050
AQRRYPTQPC 1060
Length:1,060
Mass (Da):116,604
Last modified:July 1, 2008 - v2
Checksum:iB1D1483EAB45E676
GO
Isoform 2 (identifier: Q96JE7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     592-624: SQEFLKFATTEAIQRTEIFEYCQMLGRPKSFIP → RYATWEKGNSKDIFQGTVLALVGFYGSSFHFLM
     625-1060: Missing.

Show »
Length:624
Mass (Da):70,627
Checksum:i33BFD842A0E04A94
GO
Isoform 3 (identifier: Q96JE7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-435: Missing.
     436-515: ETPAQIVEKF...MSGRIPQAAT → MRGFVHFHHA...LCRARKHRHL
     942-986: ETPRASSPHQ...RGGGEGRGSA → VGVKAEDPHP...TLVFFFLHLP
     987-1060: Missing.

Show »
Length:541
Mass (Da):59,124
Checksum:iF29B79A66232F063
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti292 – 2921H → R.2 Publications
Corresponds to variant rs12040910 [ dbSNP | Ensembl ].
VAR_044130
Natural varianti730 – 7301G → R.1 Publication
Corresponds to variant rs943762 [ dbSNP | Ensembl ].
VAR_044131
Natural varianti845 – 8451Q → H.1 Publication
Corresponds to variant rs7522194 [ dbSNP | Ensembl ].
VAR_044132
Natural varianti864 – 8641P → A.1 Publication
Corresponds to variant rs591120 [ dbSNP | Ensembl ].
VAR_044133
Natural varianti873 – 8731S → N.1 Publication
Corresponds to variant rs3813649 [ dbSNP | Ensembl ].
VAR_044134

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 435435Missing in isoform 3.
VSP_034371Add
BLAST
Alternative sequencei436 – 51580ETPAQ…PQAAT → MRGFVHFHHAAYSFLPPGGI LLPLHRPSWATWLDFLILKV AVGTRLHRVPVKIKRMCVNG LCRARKHRHL in isoform 3.
VSP_034372Add
BLAST
Alternative sequencei592 – 62433SQEFL…KSFIP → RYATWEKGNSKDIFQGTVLA LVGFYGSSFHFLM in isoform 2.
VSP_034373Add
BLAST
Alternative sequencei625 – 1060436Missing in isoform 2.
VSP_034374Add
BLAST
Alternative sequencei942 – 98645ETPRA…GRGSA → VGVKAEDPHPAGGQLRALGL EACLDQRVFPLSSAPTLVFF FLHLP in isoform 3.
VSP_034375Add
BLAST
Alternative sequencei987 – 106074Missing in isoform 3.
VSP_034376Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti134 – 1341Q → R in CAI46016. 1 Publication
Sequence conflicti195 – 1951Q → R in ABN42197. 1 Publication
Sequence conflicti262 – 2621A → AE in CAI46016. 1 Publication
Sequence conflicti262 – 2621A → AE in AAH09106. 1 Publication
Sequence conflicti514 – 5141A → T in CAI46016. 1 Publication
Sequence conflicti929 – 9291A → S in CAI46016. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB063357 mRNA. Translation: BAB61035.1.
EF125213 mRNA. Translation: ABN42197.1.
AK098627 mRNA. Translation: BAC05357.1.
BX647819 mRNA. Translation: CAI46016.1.
BC009106 mRNA. Translation: AAH09106.1.
CCDSiCCDS44281.1. [Q96JE7-1]
RefSeqiNP_149118.2. NM_033127.2. [Q96JE7-1]
UniGeneiHs.149540.

Genome annotation databases

EnsembliENST00000308284; ENSP00000308339; ENSG00000120341. [Q96JE7-1]
GeneIDi89866.
KEGGihsa:89866.
UCSCiuc001gli.1. human. [Q96JE7-1]

Polymorphism databases

DMDMi193806482.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB063357 mRNA. Translation: BAB61035.1 .
EF125213 mRNA. Translation: ABN42197.1 .
AK098627 mRNA. Translation: BAC05357.1 .
BX647819 mRNA. Translation: CAI46016.1 .
BC009106 mRNA. Translation: AAH09106.1 .
CCDSi CCDS44281.1. [Q96JE7-1 ]
RefSeqi NP_149118.2. NM_033127.2. [Q96JE7-1 ]
UniGenei Hs.149540.

3D structure databases

ProteinModelPortali Q96JE7.
SMRi Q96JE7. Positions 324-657.
ModBasei Search...

Protein-protein interaction databases

BioGridi 124624. 1 interaction.
IntActi Q96JE7. 1 interaction.
STRINGi 9606.ENSP00000308339.

PTM databases

PhosphoSitei Q96JE7.

Polymorphism databases

DMDMi 193806482.

Proteomic databases

PaxDbi Q96JE7.
PRIDEi Q96JE7.

Protocols and materials databases

DNASUi 89866.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000308284 ; ENSP00000308339 ; ENSG00000120341 . [Q96JE7-1 ]
GeneIDi 89866.
KEGGi hsa:89866.
UCSCi uc001gli.1. human. [Q96JE7-1 ]

Organism-specific databases

CTDi 89866.
GeneCardsi GC01M177896.
H-InvDB HIX0001361.
HGNCi HGNC:30301. SEC16B.
HPAi HPA031202.
MIMi 612855. gene.
neXtProti NX_Q96JE7.
PharmGKBi PA162402680.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG12793.
HOGENOMi HOG000049067.
HOVERGENi HBG108463.
OMAi ATCCGDK.
OrthoDBi EOG7MH0XQ.
PhylomeDBi Q96JE7.

Miscellaneous databases

GeneWikii SEC16B.
GenomeRNAii 89866.
NextBioi 76362.
PROi Q96JE7.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96JE7.
Bgeei Q96JE7.
CleanExi HS_SEC16B.
Genevestigatori Q96JE7.

Family and domain databases

InterProi IPR024880. Sec16.
IPR024340. Sec16_CCD.
[Graphical view ]
PANTHERi PTHR13402. PTHR13402. 1 hit.
Pfami PF12932. Sec16. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and sequencing of the cDNA coding for a novel regucalcin gene promoter region-related protein in rat, mouse and human liver."
    Misawa H., Yamaguchi M.
    Int. J. Mol. Med. 8:513-520(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-730.
    Tissue: Liver.
  2. "Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization."
    Bhattacharyya D., Glick B.S.
    Mol. Biol. Cell 18:839-849(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-292, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Liver.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS HIS-845; ALA-864 AND ASN-873.
    Tissue: Retina.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-292.
    Tissue: Placenta.
  6. "Gene expression for a novel protein RGPR-p117 in various species: the stimulation by intracellular signaling factors."
    Misawa H., Yamaguchi M.
    J. Cell. Biochem. 87:188-193(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiSC16B_HUMAN
AccessioniPrimary (citable) accession number: Q96JE7
Secondary accession number(s): A3EYF1
, Q5HYF6, Q8N7D6, Q96GX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 1, 2008
Last modified: July 9, 2014
This is version 82 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi