Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96JE7 (SC16B_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein transport protein Sec16B
Alternative name(s):
Leucine zipper transcription regulator 2
Regucalcin gene promoter region-related protein p117
Short name=RGPR-p117
SEC16 homolog B
Gene names
Name:SEC16B
Synonyms:KIAA1928, LZTR2, RGPR, SEC16S
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1060 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus and for normal transitional endoplasmic reticulum (tER) organization. Ref.2

Subunit structure

SEC16A and SEC16B are each present in multiple copies in a heteromeric complex. Ref.2

Subcellular location

Endoplasmic reticulum membrane; Peripheral membrane protein By similarity. Golgi apparatus membrane; Peripheral membrane protein By similarity Ref.2.

Tissue specificity

Ubiquitous. Ref.2 Ref.6

Sequence similarities

Belongs to the SEC16 family.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96JE7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96JE7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     592-624: SQEFLKFATTEAIQRTEIFEYCQMLGRPKSFIP → RYATWEKGNSKDIFQGTVLALVGFYGSSFHFLM
     625-1060: Missing.
Isoform 3 (identifier: Q96JE7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-435: Missing.
     436-515: ETPAQIVEKF...MSGRIPQAAT → MRGFVHFHHA...LCRARKHRHL
     942-986: ETPRASSPHQ...RGGGEGRGSA → VGVKAEDPHP...TLVFFFLHLP
     987-1060: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10601060Protein transport protein Sec16B
PRO_0000341974

Regions

Region34 – 224191Required for endoplasmic reticulum localization
Compositional bias88 – 12639Tyr-rich
Compositional bias232 – 2354Poly-Ser

Amino acid modifications

Modified residue1881Phosphoserine By similarity
Modified residue8711Phosphoserine By similarity
Modified residue8741Phosphoserine By similarity
Modified residue8821Phosphoserine By similarity
Modified residue8831Phosphoserine By similarity

Natural variations

Alternative sequence1 – 435435Missing in isoform 3.
VSP_034371
Alternative sequence436 – 51580ETPAQ…PQAAT → MRGFVHFHHAAYSFLPPGGI LLPLHRPSWATWLDFLILKV AVGTRLHRVPVKIKRMCVNG LCRARKHRHL in isoform 3.
VSP_034372
Alternative sequence592 – 62433SQEFL…KSFIP → RYATWEKGNSKDIFQGTVLA LVGFYGSSFHFLM in isoform 2.
VSP_034373
Alternative sequence625 – 1060436Missing in isoform 2.
VSP_034374
Alternative sequence942 – 98645ETPRA…GRGSA → VGVKAEDPHPAGGQLRALGL EACLDQRVFPLSSAPTLVFF FLHLP in isoform 3.
VSP_034375
Alternative sequence987 – 106074Missing in isoform 3.
VSP_034376
Natural variant2921H → R. Ref.2 Ref.5
Corresponds to variant rs12040910 [ dbSNP | Ensembl ].
VAR_044130
Natural variant7301G → R. Ref.1
Corresponds to variant rs943762 [ dbSNP | Ensembl ].
VAR_044131
Natural variant8451Q → H. Ref.4
Corresponds to variant rs7522194 [ dbSNP | Ensembl ].
VAR_044132
Natural variant8641P → A. Ref.4
Corresponds to variant rs591120 [ dbSNP | Ensembl ].
VAR_044133
Natural variant8731S → N. Ref.4
Corresponds to variant rs3813649 [ dbSNP | Ensembl ].
VAR_044134

Experimental info

Sequence conflict1341Q → R in CAI46016. Ref.4
Sequence conflict1951Q → R in ABN42197. Ref.2
Sequence conflict2621A → AE in CAI46016. Ref.4
Sequence conflict2621A → AE in AAH09106. Ref.5
Sequence conflict5141A → T in CAI46016. Ref.4
Sequence conflict9291A → S in CAI46016. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified July 1, 2008. Version 2.
Checksum: B1D1483EAB45E676

FASTA1,060116,604
        10         20         30         40         50         60 
MELWAPQRLP QTRGKATAPS KDPDRGFRRD GHHRPVPHSW HNGERFHQWQ DNRGSPQPQQ 

        70         80         90        100        110        120 
EPRADHQQQP HYASRPGDWH QPVSGVDYYE GGYRNQLYSR PGYENSYQSY QSPTMREEYA 

       130        140        150        160        170        180 
YGSYYYHGHP QWLQEERVPR QRSPYIWHED YREQKYLDEH HYENQHSPFG TNSETHFQSN 

       190        200        210        220        230        240 
SRNPCKDSPA SNSGQEWPGE LFPGSLLAEA QKNKPSLASE SNLLQQRESG LSSSSYELSQ 

       250        260        270        280        290        300 
YIRDAPERDD PPASAAWSPV QADVSSAGPK APMKFYIPHV PVSFGPGGQL VHVGPSSPTD 

       310        320        330        340        350        360 
GQAALVELHS MEVILNDSEE QEEMRSFSGP LIREDVHKVD IMTFCQQKAA QSCKSETLGS 

       370        380        390        400        410        420 
RDSALLWQLL VLLCRQNGSM VGSDIAELLM QDCKKLEKYK RQPPVANLIN LTDEDWPVLS 

       430        440        450        460        470        480 
SGTPNLLTGE IPPSVETPAQ IVEKFTRLLY YGRKKEALEW AMKNHLWGHA LFLSSKMDPQ 

       490        500        510        520        530        540 
TYSWVMSGFT STLALNDPLQ TLFQLMSGRI PQAATCCGEK QWGDWRPHLA VILSNQAGDP 

       550        560        570        580        590        600 
ELYQRAIVAI GDTLAGKGLV EAAHFCYLMA HVPFGHYTVK TDHLVLLGSS HSQEFLKFAT 

       610        620        630        640        650        660 
TEAIQRTEIF EYCQMLGRPK SFIPSFQVYK LLYASRLADY GLVSQALHYC EAIGAAVLSQ 

       670        680        690        700        710        720 
GESSHPVLLV ELIKLAEKLK LSDPLVLERR SGDRDLEPDW LAQLRRQLEQ KVAGDIGDPH 

       730        740        750        760        770        780 
PTRSDISGAG GTTTENTFYQ DFSGCQGYSE APGYRSALWL TPEQTCLLQP SPQQPFPLQP 

       790        800        810        820        830        840 
GSYPAGGGAG QTGTPRPFYS VPETHLPGTG SSVAVTEATG GTVWEEMLQT HLGPGENTVS 

       850        860        870        880        890        900 
QETSQPPDGQ EVISKPQTPL AARPRSISES SASSAKEDEK ESSDEADKNS PRNTAQRGKL 

       910        920        930        940        950        960 
GDGKEHTKSS GFGWFSWFRS KPTKNASPAG DEDSSDSPDS EETPRASSPH QAGLGLSLTP 

       970        980        990       1000       1010       1020 
SPESPPLPDV SAFSRGRGGG EGRGSASSGG AAAGAGVGGL SGPESVSFEL CSNPGVLLPP 

      1030       1040       1050       1060 
PALKGAVPLY NPSQVPQLPT ATSLNRPNRL AQRRYPTQPC 

« Hide

Isoform 2 [UniParc].

Checksum: 33BFD842A0E04A94
Show »

FASTA62470,627
Isoform 3 [UniParc].

Checksum: F29B79A66232F063
Show »

FASTA54159,124

References

« Hide 'large scale' references
[1]"Molecular cloning and sequencing of the cDNA coding for a novel regucalcin gene promoter region-related protein in rat, mouse and human liver."
Misawa H., Yamaguchi M.
Int. J. Mol. Med. 8:513-520(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-730.
Tissue: Liver.
[2]"Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization."
Bhattacharyya D., Glick B.S.
Mol. Biol. Cell 18:839-849(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-292, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Liver.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS HIS-845; ALA-864 AND ASN-873.
Tissue: Retina.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-292.
Tissue: Placenta.
[6]"Gene expression for a novel protein RGPR-p117 in various species: the stimulation by intracellular signaling factors."
Misawa H., Yamaguchi M.
J. Cell. Biochem. 87:188-193(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB063357 mRNA. Translation: BAB61035.1.
EF125213 mRNA. Translation: ABN42197.1.
AK098627 mRNA. Translation: BAC05357.1.
BX647819 mRNA. Translation: CAI46016.1.
BC009106 mRNA. Translation: AAH09106.1.
RefSeqNP_149118.2. NM_033127.2.
UniGeneHs.149540.

3D structure databases

ProteinModelPortalQ96JE7.
SMRQ96JE7. Positions 324-657.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124624. 1 interaction.
IntActQ96JE7. 1 interaction.
STRING9606.ENSP00000308339.

PTM databases

PhosphoSiteQ96JE7.

Polymorphism databases

DMDM193806482.

Proteomic databases

PaxDbQ96JE7.
PRIDEQ96JE7.

Protocols and materials databases

DNASU89866.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000308284; ENSP00000308339; ENSG00000120341. [Q96JE7-1]
GeneID89866.
KEGGhsa:89866.
UCSCuc001gli.1. human. [Q96JE7-1]

Organism-specific databases

CTD89866.
GeneCardsGC01M177896.
H-InvDBHIX0001361.
HGNCHGNC:30301. SEC16B.
HPAHPA031202.
MIM612855. gene.
neXtProtNX_Q96JE7.
PharmGKBPA162402680.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG12793.
HOGENOMHOG000049067.
HOVERGENHBG108463.
OMAATCCGDK.
OrthoDBEOG7MH0XQ.
PhylomeDBQ96JE7.

Gene expression databases

ArrayExpressQ96JE7.
BgeeQ96JE7.
CleanExHS_SEC16B.
GenevestigatorQ96JE7.

Family and domain databases

InterProIPR024880. Sec16.
IPR024340. Sec16_CCD.
[Graphical view]
PANTHERPTHR13402. PTHR13402. 1 hit.
PfamPF12932. Sec16. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSEC16B.
GenomeRNAi89866.
NextBio76362.
PROQ96JE7.
SOURCESearch...

Entry information

Entry nameSC16B_HUMAN
AccessionPrimary (citable) accession number: Q96JE7
Secondary accession number(s): A3EYF1 expand/collapse secondary AC list , Q5HYF6, Q8N7D6, Q96GX6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 1, 2008
Last sequence update: July 1, 2008
Last modified: April 16, 2014
This is version 80 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM