Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JE7

- SC16B_HUMAN

UniProt

Q96JE7 - SC16B_HUMAN

Protein

Protein transport protein Sec16B

Gene

SEC16B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 2 (01 Jul 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus and for normal transitional endoplasmic reticulum (tER) organization.1 Publication

    GO - Biological processi

    1. COPII vesicle coating Source: InterPro
    2. endoplasmic reticulum organization Source: UniProtKB
    3. peroxisome fission Source: UniProtKB
    4. peroxisome organization Source: UniProtKB
    5. positive regulation of gene expression Source: UniProtKB
    6. positive regulation of protein exit from endoplasmic reticulum Source: UniProtKB
    7. protein localization to endoplasmic reticulum Source: UniProtKB
    8. protein transport Source: UniProtKB-KW

    Keywords - Biological processi

    ER-Golgi transport, Protein transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein transport protein Sec16B
    Alternative name(s):
    Leucine zipper transcription regulator 2
    Regucalcin gene promoter region-related protein p117
    Short name:
    RGPR-p117
    SEC16 homolog B
    Gene namesi
    Name:SEC16B
    Synonyms:KIAA1928, LZTR2, RGPR, SEC16S
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:30301. SEC16B.

    Subcellular locationi

    GO - Cellular componenti

    1. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    2. Golgi membrane Source: UniProtKB-SubCell
    3. intracellular membrane-bounded organelle Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162402680.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10601060Protein transport protein Sec16BPRO_0000341974Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei188 – 1881PhosphoserineBy similarity
    Modified residuei871 – 8711PhosphoserineBy similarity
    Modified residuei874 – 8741PhosphoserineBy similarity
    Modified residuei882 – 8821PhosphoserineBy similarity
    Modified residuei883 – 8831PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ96JE7.
    PRIDEiQ96JE7.

    PTM databases

    PhosphoSiteiQ96JE7.

    Expressioni

    Tissue specificityi

    Ubiquitous.2 Publications

    Gene expression databases

    ArrayExpressiQ96JE7.
    BgeeiQ96JE7.
    CleanExiHS_SEC16B.
    GenevestigatoriQ96JE7.

    Organism-specific databases

    HPAiHPA031202.

    Interactioni

    Subunit structurei

    SEC16A and SEC16B are each present in multiple copies in a heteromeric complex.1 Publication

    Protein-protein interaction databases

    BioGridi124624. 1 interaction.
    IntActiQ96JE7. 1 interaction.
    STRINGi9606.ENSP00000308339.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96JE7.
    SMRiQ96JE7. Positions 324-657.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni34 – 224191Required for endoplasmic reticulum localizationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi88 – 12639Tyr-richAdd
    BLAST
    Compositional biasi232 – 2354Poly-Ser

    Sequence similaritiesi

    Belongs to the SEC16 family.Curated

    Phylogenomic databases

    eggNOGiNOG12793.
    HOGENOMiHOG000049067.
    HOVERGENiHBG108463.
    OMAiATCCGDK.
    OrthoDBiEOG7MH0XQ.
    PhylomeDBiQ96JE7.

    Family and domain databases

    InterProiIPR024880. Sec16.
    IPR024340. Sec16_CCD.
    [Graphical view]
    PANTHERiPTHR13402. PTHR13402. 1 hit.
    PfamiPF12932. Sec16. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JE7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELWAPQRLP QTRGKATAPS KDPDRGFRRD GHHRPVPHSW HNGERFHQWQ     50
    DNRGSPQPQQ EPRADHQQQP HYASRPGDWH QPVSGVDYYE GGYRNQLYSR 100
    PGYENSYQSY QSPTMREEYA YGSYYYHGHP QWLQEERVPR QRSPYIWHED 150
    YREQKYLDEH HYENQHSPFG TNSETHFQSN SRNPCKDSPA SNSGQEWPGE 200
    LFPGSLLAEA QKNKPSLASE SNLLQQRESG LSSSSYELSQ YIRDAPERDD 250
    PPASAAWSPV QADVSSAGPK APMKFYIPHV PVSFGPGGQL VHVGPSSPTD 300
    GQAALVELHS MEVILNDSEE QEEMRSFSGP LIREDVHKVD IMTFCQQKAA 350
    QSCKSETLGS RDSALLWQLL VLLCRQNGSM VGSDIAELLM QDCKKLEKYK 400
    RQPPVANLIN LTDEDWPVLS SGTPNLLTGE IPPSVETPAQ IVEKFTRLLY 450
    YGRKKEALEW AMKNHLWGHA LFLSSKMDPQ TYSWVMSGFT STLALNDPLQ 500
    TLFQLMSGRI PQAATCCGEK QWGDWRPHLA VILSNQAGDP ELYQRAIVAI 550
    GDTLAGKGLV EAAHFCYLMA HVPFGHYTVK TDHLVLLGSS HSQEFLKFAT 600
    TEAIQRTEIF EYCQMLGRPK SFIPSFQVYK LLYASRLADY GLVSQALHYC 650
    EAIGAAVLSQ GESSHPVLLV ELIKLAEKLK LSDPLVLERR SGDRDLEPDW 700
    LAQLRRQLEQ KVAGDIGDPH PTRSDISGAG GTTTENTFYQ DFSGCQGYSE 750
    APGYRSALWL TPEQTCLLQP SPQQPFPLQP GSYPAGGGAG QTGTPRPFYS 800
    VPETHLPGTG SSVAVTEATG GTVWEEMLQT HLGPGENTVS QETSQPPDGQ 850
    EVISKPQTPL AARPRSISES SASSAKEDEK ESSDEADKNS PRNTAQRGKL 900
    GDGKEHTKSS GFGWFSWFRS KPTKNASPAG DEDSSDSPDS EETPRASSPH 950
    QAGLGLSLTP SPESPPLPDV SAFSRGRGGG EGRGSASSGG AAAGAGVGGL 1000
    SGPESVSFEL CSNPGVLLPP PALKGAVPLY NPSQVPQLPT ATSLNRPNRL 1050
    AQRRYPTQPC 1060
    Length:1,060
    Mass (Da):116,604
    Last modified:July 1, 2008 - v2
    Checksum:iB1D1483EAB45E676
    GO
    Isoform 2 (identifier: Q96JE7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         592-624: SQEFLKFATTEAIQRTEIFEYCQMLGRPKSFIP → RYATWEKGNSKDIFQGTVLALVGFYGSSFHFLM
         625-1060: Missing.

    Show »
    Length:624
    Mass (Da):70,627
    Checksum:i33BFD842A0E04A94
    GO
    Isoform 3 (identifier: Q96JE7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-435: Missing.
         436-515: ETPAQIVEKF...MSGRIPQAAT → MRGFVHFHHA...LCRARKHRHL
         942-986: ETPRASSPHQ...RGGGEGRGSA → VGVKAEDPHP...TLVFFFLHLP
         987-1060: Missing.

    Show »
    Length:541
    Mass (Da):59,124
    Checksum:iF29B79A66232F063
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti134 – 1341Q → R in CAI46016. (PubMed:17974005)Curated
    Sequence conflicti195 – 1951Q → R in ABN42197. (PubMed:17192411)Curated
    Sequence conflicti262 – 2621A → AE in CAI46016. (PubMed:17974005)Curated
    Sequence conflicti262 – 2621A → AE in AAH09106. (PubMed:15489334)Curated
    Sequence conflicti514 – 5141A → T in CAI46016. (PubMed:17974005)Curated
    Sequence conflicti929 – 9291A → S in CAI46016. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti292 – 2921H → R.2 Publications
    Corresponds to variant rs12040910 [ dbSNP | Ensembl ].
    VAR_044130
    Natural varianti730 – 7301G → R.1 Publication
    Corresponds to variant rs943762 [ dbSNP | Ensembl ].
    VAR_044131
    Natural varianti845 – 8451Q → H.1 Publication
    Corresponds to variant rs7522194 [ dbSNP | Ensembl ].
    VAR_044132
    Natural varianti864 – 8641P → A.1 Publication
    Corresponds to variant rs591120 [ dbSNP | Ensembl ].
    VAR_044133
    Natural varianti873 – 8731S → N.1 Publication
    Corresponds to variant rs3813649 [ dbSNP | Ensembl ].
    VAR_044134

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 435435Missing in isoform 3. 1 PublicationVSP_034371Add
    BLAST
    Alternative sequencei436 – 51580ETPAQ…PQAAT → MRGFVHFHHAAYSFLPPGGI LLPLHRPSWATWLDFLILKV AVGTRLHRVPVKIKRMCVNG LCRARKHRHL in isoform 3. 1 PublicationVSP_034372Add
    BLAST
    Alternative sequencei592 – 62433SQEFL…KSFIP → RYATWEKGNSKDIFQGTVLA LVGFYGSSFHFLM in isoform 2. 1 PublicationVSP_034373Add
    BLAST
    Alternative sequencei625 – 1060436Missing in isoform 2. 1 PublicationVSP_034374Add
    BLAST
    Alternative sequencei942 – 98645ETPRA…GRGSA → VGVKAEDPHPAGGQLRALGL EACLDQRVFPLSSAPTLVFF FLHLP in isoform 3. 1 PublicationVSP_034375Add
    BLAST
    Alternative sequencei987 – 106074Missing in isoform 3. 1 PublicationVSP_034376Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB063357 mRNA. Translation: BAB61035.1.
    EF125213 mRNA. Translation: ABN42197.1.
    AK098627 mRNA. Translation: BAC05357.1.
    BX647819 mRNA. Translation: CAI46016.1.
    BC009106 mRNA. Translation: AAH09106.1.
    CCDSiCCDS44281.1. [Q96JE7-1]
    RefSeqiNP_149118.2. NM_033127.2. [Q96JE7-1]
    UniGeneiHs.149540.

    Genome annotation databases

    EnsembliENST00000308284; ENSP00000308339; ENSG00000120341. [Q96JE7-1]
    GeneIDi89866.
    KEGGihsa:89866.
    UCSCiuc001gli.1. human. [Q96JE7-1]

    Polymorphism databases

    DMDMi193806482.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB063357 mRNA. Translation: BAB61035.1 .
    EF125213 mRNA. Translation: ABN42197.1 .
    AK098627 mRNA. Translation: BAC05357.1 .
    BX647819 mRNA. Translation: CAI46016.1 .
    BC009106 mRNA. Translation: AAH09106.1 .
    CCDSi CCDS44281.1. [Q96JE7-1 ]
    RefSeqi NP_149118.2. NM_033127.2. [Q96JE7-1 ]
    UniGenei Hs.149540.

    3D structure databases

    ProteinModelPortali Q96JE7.
    SMRi Q96JE7. Positions 324-657.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124624. 1 interaction.
    IntActi Q96JE7. 1 interaction.
    STRINGi 9606.ENSP00000308339.

    PTM databases

    PhosphoSitei Q96JE7.

    Polymorphism databases

    DMDMi 193806482.

    Proteomic databases

    PaxDbi Q96JE7.
    PRIDEi Q96JE7.

    Protocols and materials databases

    DNASUi 89866.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000308284 ; ENSP00000308339 ; ENSG00000120341 . [Q96JE7-1 ]
    GeneIDi 89866.
    KEGGi hsa:89866.
    UCSCi uc001gli.1. human. [Q96JE7-1 ]

    Organism-specific databases

    CTDi 89866.
    GeneCardsi GC01M177896.
    H-InvDB HIX0001361.
    HGNCi HGNC:30301. SEC16B.
    HPAi HPA031202.
    MIMi 612855. gene.
    neXtProti NX_Q96JE7.
    PharmGKBi PA162402680.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG12793.
    HOGENOMi HOG000049067.
    HOVERGENi HBG108463.
    OMAi ATCCGDK.
    OrthoDBi EOG7MH0XQ.
    PhylomeDBi Q96JE7.

    Miscellaneous databases

    GeneWikii SEC16B.
    GenomeRNAii 89866.
    NextBioi 76362.
    PROi Q96JE7.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96JE7.
    Bgeei Q96JE7.
    CleanExi HS_SEC16B.
    Genevestigatori Q96JE7.

    Family and domain databases

    InterProi IPR024880. Sec16.
    IPR024340. Sec16_CCD.
    [Graphical view ]
    PANTHERi PTHR13402. PTHR13402. 1 hit.
    Pfami PF12932. Sec16. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and sequencing of the cDNA coding for a novel regucalcin gene promoter region-related protein in rat, mouse and human liver."
      Misawa H., Yamaguchi M.
      Int. J. Mol. Med. 8:513-520(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-730.
      Tissue: Liver.
    2. "Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization."
      Bhattacharyya D., Glick B.S.
      Mol. Biol. Cell 18:839-849(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ARG-292, FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Liver.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS HIS-845; ALA-864 AND ASN-873.
      Tissue: Retina.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ARG-292.
      Tissue: Placenta.
    6. "Gene expression for a novel protein RGPR-p117 in various species: the stimulation by intracellular signaling factors."
      Misawa H., Yamaguchi M.
      J. Cell. Biochem. 87:188-193(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiSC16B_HUMAN
    AccessioniPrimary (citable) accession number: Q96JE7
    Secondary accession number(s): A3EYF1
    , Q5HYF6, Q8N7D6, Q96GX6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 1, 2008
    Last sequence update: July 1, 2008
    Last modified: October 1, 2014
    This is version 83 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3