Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JB8

- MPP4_HUMAN

UniProt

Q96JB8 - MPP4_HUMAN

Protein

MAGUK p55 subfamily member 4

Gene

MPP4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in retinal photoreceptors development.By similarity

    GO - Biological processi

    1. protein localization to synapse Source: Ensembl

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    MAGUK p55 subfamily member 4
    Alternative name(s):
    Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein
    Discs large homolog 6
    Gene namesi
    Name:MPP4
    Synonyms:ALS2CR5, DLG6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:13680. MPP4.

    Subcellular locationi

    Cytoplasm 1 Publication
    Note: Detected at the outer limiting membrane (OLM) and in the outer plexiform layer (OPL) of the retina. At the OLM, detected apical to the adherens junction (AJ).

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. intracellular membrane-bounded organelle Source: HPA
    3. nucleus Source: HPA
    4. presynaptic membrane Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30927.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 637637MAGUK p55 subfamily member 4PRO_0000094577Add
    BLAST

    Proteomic databases

    PaxDbiQ96JB8.
    PRIDEiQ96JB8.

    PTM databases

    PhosphoSiteiQ96JB8.

    Expressioni

    Tissue specificityi

    Expressed in the retina (at protein level). Highly expressed in the retina. Lower amounts are detected in brain, testis, ARPE-19, RPE/choroid and fetal eye. Isoform 5 is retina-specific.4 Publications

    Gene expression databases

    ArrayExpressiQ96JB8.
    BgeeiQ96JB8.
    CleanExiHS_MPP4.
    GenevestigatoriQ96JB8.

    Organism-specific databases

    HPAiHPA036387.

    Interactioni

    Subunit structurei

    Interacts with MPDZ. May interact with GRIA2 By similarity. Forms a complex with CRB1 and MPP5. Interacts with FASLG.By similarity2 Publications

    Protein-protein interaction databases

    BioGridi121853. 1 interaction.
    IntActiQ96JB8. 1 interaction.
    STRINGi9606.ENSP00000387278.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96JB8.
    SMRiQ96JB8. Positions 62-235, 245-313, 428-627.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 8057L27 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini87 – 13751L27 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini154 – 23582PDZPROSITE-ProRule annotationAdd
    BLAST
    Domaini242 – 31271SH3PROSITE-ProRule annotationAdd
    BLAST
    Domaini427 – 616190Guanylate kinase-likePROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili568 – 62154Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MAGUK family.Curated
    Contains 1 guanylate kinase-like domain.PROSITE-ProRule annotation
    Contains 2 L27 domains.PROSITE-ProRule annotation
    Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation
    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiCOG0194.
    HOGENOMiHOG000233034.
    HOVERGENiHBG001858.
    InParanoidiQ96JB8.
    OMAiEDPAIPC.
    OrthoDBiEOG79CXZ5.
    PhylomeDBiQ96JB8.
    TreeFamiTF314263.

    Family and domain databases

    Gene3Di2.30.42.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProiIPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR014775. L27_C.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF00625. Guanylate_kin. 1 hit.
    PF02828. L27. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    SMARTiSM00072. GuKc. 1 hit.
    SM00569. L27. 2 hits.
    SM00228. PDZ. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JB8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MIQSDKGADP PDKKDMKLST ATNPQNGLSQ ILRLVLQELS LFYGRDVNGV    50
    CLLYDLLHSP WLQALLKIYD CLQEFKEKKL VPATPHAQVL SYEVVELLRE 100
    TPTSPEIQEL RQMLQAPHFK ALLSAHDTIA QKDFEPLLPP LPDNIPESEE 150
    AMRIVCLVKN QQPLGATIKR HEMTGDILVA RIIHGGLAER SGLLYAGDKL 200
    VEVNGVSVEG LDPEQVIHIL AMSRGTIMFK VVPVSDPPVN SQQMVYVRAM 250
    TEYWPQEDPD IPCMDAGLPF QKGDILQIVD QNDALWWQAR KISDPATCAG 300
    LVPSNHLLKR KQREFWWSQP YQPHTCLKST LSISMEEEDD MKIDEKCVEA 350
    DEETFESEEL SEDKEEFVGY GQKFFIAGFR RSMRLCRRKS HLSPLHASVC 400
    CTGSCYSAVG APYEEVVRYQ RRPSDKYRLI VLMGPSGVGV NELRRQLIEF 450
    NPSHFQSAVP HTTRTKKSYE MNGREYHYVS KETFENLIYS HRMLEYGEYK 500
    GHLYGTSVDA VQTVLVEGKI CVMDLEPQDI QGVRTHELKP YVIFIKPSNM 550
    RCMKQSRKNA KVITDYYVDM KFKDEDLQEM ENLAQRMETQ FGQFFDHVIV 600
    NDSLHDACAQ LLSAIQKAQE EPQWVPATWI SSDTESQ 637
    Length:637
    Mass (Da):72,779
    Last modified:May 18, 2010 - v2
    Checksum:iB180AE8635E32CDD
    GO
    Isoform 2 (identifier: Q96JB8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         245-257: Missing.
         332-363: SISMEEEDDMKIDEKCVEADEETFESEELSED → Y

    Show »
    Length:593
    Mass (Da):67,565
    Checksum:i2AE3ACCFDCAB8236
    GO
    Isoform 3 (identifier: Q96JB8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         121-164: Missing.
         311-637: Missing.

    Show »
    Length:266
    Mass (Da):29,771
    Checksum:i4B29F97B2268AB26
    GO
    Isoform 4 (identifier: Q96JB8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         121-164: Missing.
         311-337: KQREFWWSQPYQPHTCLKSTLSISMEE → WSFALVAQAGVQWHYLDSLQPLPPGFKRFSCLSLPRSWDYI
         358-362: Missing.

    Show »
    Length:602
    Mass (Da):68,755
    Checksum:i45A4EC99FA4BB75B
    GO
    Isoform 5 (identifier: Q96JB8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-164: Missing.

    Show »
    Length:565
    Mass (Da):64,600
    Checksum:i4A18FB861772DBA3
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti5 – 51D → G in BAD18399. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441G → S.3 Publications
    Corresponds to variant rs6725443 [ dbSNP | Ensembl ].
    VAR_022643
    Natural varianti562 – 5621V → I.
    Corresponds to variant rs11894115 [ dbSNP | Ensembl ].
    VAR_050015

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei93 – 16472Missing in isoform 5. CuratedVSP_013991Add
    BLAST
    Alternative sequencei121 – 16444Missing in isoform 3 and isoform 4. 2 PublicationsVSP_003157Add
    BLAST
    Alternative sequencei245 – 25713Missing in isoform 2. 1 PublicationVSP_003159Add
    BLAST
    Alternative sequencei311 – 637327Missing in isoform 3. 1 PublicationVSP_003158Add
    BLAST
    Alternative sequencei311 – 33727KQREF…ISMEE → WSFALVAQAGVQWHYLDSLQ PLPPGFKRFSCLSLPRSWDY I in isoform 4. 1 PublicationVSP_013992Add
    BLAST
    Alternative sequencei332 – 36332SISME…ELSED → Y in isoform 2. 1 PublicationVSP_003160Add
    BLAST
    Alternative sequencei358 – 3625Missing in isoform 4. 1 PublicationVSP_013993

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF316032 mRNA. Translation: AAK71862.1.
    AB053302 mRNA. Translation: BAB69012.1.
    AB053303 mRNA. Translation: BAB69013.1.
    AK131208 mRNA. Translation: BAD18399.1.
    AC007279 Genomic DNA. Translation: AAY15057.1.
    CCDSiCCDS46491.1. [Q96JB8-1]
    RefSeqiNP_149055.1. NM_033066.2.
    XP_005246790.1. XM_005246733.2. [Q96JB8-4]
    XP_005246791.1. XM_005246734.2. [Q96JB8-2]
    UniGeneiHs.63085.

    Genome annotation databases

    EnsembliENST00000315506; ENSP00000319363; ENSG00000082126. [Q96JB8-2]
    ENST00000409474; ENSP00000387278; ENSG00000082126. [Q96JB8-1]
    GeneIDi58538.
    KEGGihsa:58538.
    UCSCiuc002uyj.4. human. [Q96JB8-4]
    uc002uyk.4. human. [Q96JB8-1]
    uc002uym.1. human. [Q96JB8-3]
    uc010ftk.3. human. [Q96JB8-2]

    Polymorphism databases

    DMDMi296438297.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF316032 mRNA. Translation: AAK71862.1 .
    AB053302 mRNA. Translation: BAB69012.1 .
    AB053303 mRNA. Translation: BAB69013.1 .
    AK131208 mRNA. Translation: BAD18399.1 .
    AC007279 Genomic DNA. Translation: AAY15057.1 .
    CCDSi CCDS46491.1. [Q96JB8-1 ]
    RefSeqi NP_149055.1. NM_033066.2.
    XP_005246790.1. XM_005246733.2. [Q96JB8-4 ]
    XP_005246791.1. XM_005246734.2. [Q96JB8-2 ]
    UniGenei Hs.63085.

    3D structure databases

    ProteinModelPortali Q96JB8.
    SMRi Q96JB8. Positions 62-235, 245-313, 428-627.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121853. 1 interaction.
    IntActi Q96JB8. 1 interaction.
    STRINGi 9606.ENSP00000387278.

    PTM databases

    PhosphoSitei Q96JB8.

    Polymorphism databases

    DMDMi 296438297.

    Proteomic databases

    PaxDbi Q96JB8.
    PRIDEi Q96JB8.

    Protocols and materials databases

    DNASUi 58538.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000315506 ; ENSP00000319363 ; ENSG00000082126 . [Q96JB8-2 ]
    ENST00000409474 ; ENSP00000387278 ; ENSG00000082126 . [Q96JB8-1 ]
    GeneIDi 58538.
    KEGGi hsa:58538.
    UCSCi uc002uyj.4. human. [Q96JB8-4 ]
    uc002uyk.4. human. [Q96JB8-1 ]
    uc002uym.1. human. [Q96JB8-3 ]
    uc010ftk.3. human. [Q96JB8-2 ]

    Organism-specific databases

    CTDi 58538.
    GeneCardsi GC02M202509.
    HGNCi HGNC:13680. MPP4.
    HPAi HPA036387.
    MIMi 606575. gene.
    neXtProti NX_Q96JB8.
    PharmGKBi PA30927.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0194.
    HOGENOMi HOG000233034.
    HOVERGENi HBG001858.
    InParanoidi Q96JB8.
    OMAi EDPAIPC.
    OrthoDBi EOG79CXZ5.
    PhylomeDBi Q96JB8.
    TreeFami TF314263.

    Miscellaneous databases

    GenomeRNAii 58538.
    NextBioi 65122.
    PROi Q96JB8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96JB8.
    Bgeei Q96JB8.
    CleanExi HS_MPP4.
    Genevestigatori Q96JB8.

    Family and domain databases

    Gene3Di 2.30.42.10. 1 hit.
    3.40.50.300. 2 hits.
    InterProi IPR008145. GK/Ca_channel_bsu.
    IPR008144. Guanylate_kin-like.
    IPR020590. Guanylate_kinase_CS.
    IPR004172. L27.
    IPR014775. L27_C.
    IPR027417. P-loop_NTPase.
    IPR001478. PDZ.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF00625. Guanylate_kin. 1 hit.
    PF02828. L27. 1 hit.
    PF00595. PDZ. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    SMARTi SM00072. GuKc. 1 hit.
    SM00569. L27. 2 hits.
    SM00228. PDZ. 1 hit.
    SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    SSF50156. SSF50156. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS00856. GUANYLATE_KINASE_1. 1 hit.
    PS50052. GUANYLATE_KINASE_2. 1 hit.
    PS51022. L27. 2 hits.
    PS50106. PDZ. 1 hit.
    PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of the human retina-specific gene MPP4, a novel member of the p55 subfamily of MAGUK proteins."
      Stoehr H., Weber B.H.F.
      Genomics 74:377-384(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT SER-44.
      Tissue: Retina.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3), VARIANT SER-44.
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT SER-44.
      Tissue: Teratocarcinoma.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Characterization of MPP4, a gene highly expressed in photoreceptor cells, and mutation analysis in retinitis pigmentosa."
      Conte I., Lestingi M., den Hollander A., Miano M.G., Alfano G., Circolo D., Pugliese M., Testa F., Simonelli F., Rinaldi E., Baiget M., Banfi S., Ciccodicola A.
      Gene 297:33-38(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION (ISOFORM 5), TISSUE SPECIFICITY.
    6. Cited for: INTERACTION WITH CRB1 AND MPP5, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    7. "Membrane-associated guanylate kinase proteins MPP4 and MPP5 associate with Veli3 at distinct intercellular junctions of the neurosensory retina."
      Stoehr H., Molday L.L., Molday R.S., Weber B.H.F., Biedermann B., Reichenbach A., Kraemer F.
      J. Comp. Neurol. 481:31-41(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
      Voss M., Lettau M., Janssen O.
      BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FASLG.

    Entry informationi

    Entry nameiMPP4_HUMAN
    AccessioniPrimary (citable) accession number: Q96JB8
    Secondary accession number(s): C9IZK4
    , Q53TT3, Q6ZNH6, Q96Q43, Q96Q44
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2003
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 118 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3