Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MAGUK p55 subfamily member 4

Gene

MPP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in retinal photoreceptors development.By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
MAGUK p55 subfamily member 4
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein
Discs large homolog 6
Gene namesi
Name:MPP4
Synonyms:ALS2CR5, DLG6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000082126.17
HGNCiHGNC:13680 MPP4
MIMi606575 gene
neXtProtiNX_Q96JB8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi58538
MalaCardsiMPP4
OpenTargetsiENSG00000082126
PharmGKBiPA30927

Polymorphism and mutation databases

BioMutaiMPP4
DMDMi296438297

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945771 – 637MAGUK p55 subfamily member 4Add BLAST637

Proteomic databases

PaxDbiQ96JB8
PeptideAtlasiQ96JB8
PRIDEiQ96JB8

PTM databases

iPTMnetiQ96JB8
PhosphoSitePlusiQ96JB8

Expressioni

Tissue specificityi

Expressed in the retina (at protein level). Highly expressed in the retina. Lower amounts are detected in brain, testis, ARPE-19, RPE/choroid and fetal eye. Isoform 5 is retina-specific.4 Publications

Gene expression databases

BgeeiENSG00000082126
CleanExiHS_MPP4
ExpressionAtlasiQ96JB8 baseline and differential
GenevisibleiQ96JB8 HS

Organism-specific databases

HPAiHPA036387

Interactioni

Subunit structurei

Interacts with MPDZ. May interact with GRIA2 (By similarity). Forms a complex with CRB1 and MPP5. Interacts with FASLG.By similarity2 Publications

Protein-protein interaction databases

BioGridi121853, 1 interactor
CORUMiQ96JB8
IntActiQ96JB8, 1 interactor
STRINGi9606.ENSP00000387278

Structurei

3D structure databases

ProteinModelPortaliQ96JB8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini24 – 80L27 1PROSITE-ProRule annotationAdd BLAST57
Domaini87 – 137L27 2PROSITE-ProRule annotationAdd BLAST51
Domaini154 – 235PDZPROSITE-ProRule annotationAdd BLAST82
Domaini242 – 312SH3PROSITE-ProRule annotationAdd BLAST71
Domaini427 – 616Guanylate kinase-likePROSITE-ProRule annotationAdd BLAST190

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili568 – 621Sequence analysisAdd BLAST54

Sequence similaritiesi

Belongs to the MAGUK family.Curated

Keywords - Domaini

Coiled coil, Repeat, SH3 domain

Phylogenomic databases

eggNOGiKOG0609 Eukaryota
COG0194 LUCA
GeneTreeiENSGT00760000118866
HOGENOMiHOG000233034
HOVERGENiHBG001858
InParanoidiQ96JB8
KOiK21109
OMAiFYSRDVN
OrthoDBiEOG091G065I
PhylomeDBiQ96JB8
TreeFamiTF314263

Family and domain databases

CDDicd12034 SH3_MPP4, 1 hit
InterProiView protein in InterPro
IPR008145 GK/Ca_channel_bsu
IPR008144 Guanylate_kin-like_dom
IPR020590 Guanylate_kinase_CS
IPR014775 L27_C
IPR004172 L27_dom
IPR036892 L27_dom_sf
IPR035600 MPP4_SH3
IPR027417 P-loop_NTPase
IPR001478 PDZ
IPR036034 PDZ_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF02828 L27, 1 hit
PF00595 PDZ, 1 hit
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SM00569 L27, 2 hits
SM00228 PDZ, 1 hit
SM00326 SH3, 1 hit
SUPFAMiSSF101288 SSF101288, 1 hit
SSF50044 SSF50044, 1 hit
SSF50156 SSF50156, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS00856 GUANYLATE_KINASE_1, 1 hit
PS50052 GUANYLATE_KINASE_2, 1 hit
PS51022 L27, 2 hits
PS50106 PDZ, 1 hit
PS50002 SH3, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96JB8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIQSDKGADP PDKKDMKLST ATNPQNGLSQ ILRLVLQELS LFYGRDVNGV
60 70 80 90 100
CLLYDLLHSP WLQALLKIYD CLQEFKEKKL VPATPHAQVL SYEVVELLRE
110 120 130 140 150
TPTSPEIQEL RQMLQAPHFK ALLSAHDTIA QKDFEPLLPP LPDNIPESEE
160 170 180 190 200
AMRIVCLVKN QQPLGATIKR HEMTGDILVA RIIHGGLAER SGLLYAGDKL
210 220 230 240 250
VEVNGVSVEG LDPEQVIHIL AMSRGTIMFK VVPVSDPPVN SQQMVYVRAM
260 270 280 290 300
TEYWPQEDPD IPCMDAGLPF QKGDILQIVD QNDALWWQAR KISDPATCAG
310 320 330 340 350
LVPSNHLLKR KQREFWWSQP YQPHTCLKST LSISMEEEDD MKIDEKCVEA
360 370 380 390 400
DEETFESEEL SEDKEEFVGY GQKFFIAGFR RSMRLCRRKS HLSPLHASVC
410 420 430 440 450
CTGSCYSAVG APYEEVVRYQ RRPSDKYRLI VLMGPSGVGV NELRRQLIEF
460 470 480 490 500
NPSHFQSAVP HTTRTKKSYE MNGREYHYVS KETFENLIYS HRMLEYGEYK
510 520 530 540 550
GHLYGTSVDA VQTVLVEGKI CVMDLEPQDI QGVRTHELKP YVIFIKPSNM
560 570 580 590 600
RCMKQSRKNA KVITDYYVDM KFKDEDLQEM ENLAQRMETQ FGQFFDHVIV
610 620 630
NDSLHDACAQ LLSAIQKAQE EPQWVPATWI SSDTESQ
Length:637
Mass (Da):72,779
Last modified:May 18, 2010 - v2
Checksum:iB180AE8635E32CDD
GO
Isoform 2 (identifier: Q96JB8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     245-257: Missing.
     332-363: SISMEEEDDMKIDEKCVEADEETFESEELSED → Y

Show »
Length:593
Mass (Da):67,565
Checksum:i2AE3ACCFDCAB8236
GO
Isoform 3 (identifier: Q96JB8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-164: Missing.
     311-637: Missing.

Show »
Length:266
Mass (Da):29,771
Checksum:i4B29F97B2268AB26
GO
Isoform 4 (identifier: Q96JB8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     121-164: Missing.
     311-337: KQREFWWSQPYQPHTCLKSTLSISMEE → WSFALVAQAGVQWHYLDSLQPLPPGFKRFSCLSLPRSWDYI
     358-362: Missing.

Show »
Length:602
Mass (Da):68,755
Checksum:i45A4EC99FA4BB75B
GO
Isoform 5 (identifier: Q96JB8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-164: Missing.

Show »
Length:565
Mass (Da):64,600
Checksum:i4A18FB861772DBA3
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5D → G in BAD18399 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02264344G → S3 PublicationsCorresponds to variant dbSNP:rs6725443Ensembl.1
Natural variantiVAR_050015562V → I. Corresponds to variant dbSNP:rs11894115Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_01399193 – 164Missing in isoform 5. CuratedAdd BLAST72
Alternative sequenceiVSP_003157121 – 164Missing in isoform 3 and isoform 4. 2 PublicationsAdd BLAST44
Alternative sequenceiVSP_003159245 – 257Missing in isoform 2. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_003158311 – 637Missing in isoform 3. 1 PublicationAdd BLAST327
Alternative sequenceiVSP_013992311 – 337KQREF…ISMEE → WSFALVAQAGVQWHYLDSLQ PLPPGFKRFSCLSLPRSWDY I in isoform 4. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_003160332 – 363SISME…ELSED → Y in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_013993358 – 362Missing in isoform 4. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF316032 mRNA Translation: AAK71862.1
AB053302 mRNA Translation: BAB69012.1
AB053303 mRNA Translation: BAB69013.1
AK131208 mRNA Translation: BAD18399.1
AC007279 Genomic DNA Translation: AAY15057.1
CCDSiCCDS46491.1 [Q96JB8-1]
RefSeqiNP_149055.1, NM_033066.2
UniGeneiHs.63085

Genome annotation databases

EnsembliENST00000315506; ENSP00000319363; ENSG00000082126 [Q96JB8-2]
ENST00000409474; ENSP00000387278; ENSG00000082126 [Q96JB8-1]
GeneIDi58538
KEGGihsa:58538
UCSCiuc002uyk.5 human [Q96JB8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMPP4_HUMAN
AccessioniPrimary (citable) accession number: Q96JB8
Secondary accession number(s): C9IZK4
, Q53TT3, Q6ZNH6, Q96Q43, Q96Q44
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: May 18, 2010
Last modified: May 23, 2018
This is version 152 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health