Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Membrane-spanning 4-domains subfamily A member 14

Gene

MS4A14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

May be involved in signal transduction as a component of a multimeric receptor complex.HMP:

Keywordsi

Molecular functionReceptor

Protein family/group databases

TCDBi1.A.37.3.1. the cd20 ca(2+) channel (cd20) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-spanning 4-domains subfamily A member 14
Alternative name(s):
Testis development protein NYD-SP21
Gene namesi
Name:MS4A14
Synonyms:MS4A13, MS4A16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000166928.10.
HGNCiHGNC:30706. MS4A14.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei50 – 70HelicalIEP:Add BLAST21
Transmembranei76 – 96HelicalIEP:Add BLAST21
Transmembranei110 – 130HelicalIEP:Add BLAST21
Transmembranei141 – 161HelicalIEP:Add BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000166928.
PharmGKBiPA162396237.

Polymorphism and mutation databases

BioMutaiMS4A14.
DMDMi296434579.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003209671 – 679Membrane-spanning 4-domains subfamily A member 14Add BLAST679

Proteomic databases

PaxDbiQ96JA4.
PeptideAtlasiQ96JA4.
PRIDEiQ96JA4.

PTM databases

iPTMnetiQ96JA4.
PhosphoSitePlusiQ96JA4.

Expressioni

Gene expression databases

BgeeiENSG00000166928.
CleanExiHS_MS4A13.
HS_MS4A14.
ExpressionAtlasiQ96JA4. baseline and differential.
GenevisibleiQ96JA4. HS.

Interactioni

Protein-protein interaction databases

IntActiQ96JA4. 6 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ96JA4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi426 – 665Gln-richAdd BLAST240

Sequence similaritiesi

Belongs to the MS4A family.IKR:

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J0WH. Eukaryota.
ENOG410ZA7V. LUCA.
GeneTreeiENSGT00730000111143.
HOGENOMiHOG000168377.
HOVERGENiHBG067611.
InParanoidiQ96JA4.
KOiK22192.
OMAiFRSKCWT.
OrthoDBiEOG091G0IBB.
PhylomeDBiQ96JA4.
TreeFamiTF337098.

Family and domain databases

InterProiView protein in InterPro
IPR007237. CD20-like.
IPR030417. MS4A.
PANTHERiPTHR23320. PTHR23320. 3 hits.
PfamiView protein in Pfam
PF04103. CD20. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96JA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESTSQDRRA THVITIKPNE TVLTAFPYRP HSSLLDFLKG EPRVLGATQI
60 70 80 90 100
LLALIIVGFG TIFALNYIGF SQRLPLVVLT GYPFWGALIF ILTGYLTVTD
110 120 130 140 150
KKSKLLGQGV TGMNVISSLV AITGITFTIL SYRHQDKYCQ MPSFEEICVF
160 170 180 190 200
SRTLFIVLFF LPSDVTQNSE QPAPEENDQL QFVLQEEFSS DDSTTNAQSV
210 220 230 240 250
IFGGYAFFKL TLSRSPLVSQ PGNKGREFVP DEQKQSILPS PKFSEEEIEP
260 270 280 290 300
LPPTLEKKPS ENMSIQLDST FKQMKDEDLQ SAIVQPSQMQ TKLLQDQAAS
310 320 330 340 350
LQVFPSHSAL KLEDISPEDL PSQALPVEGL SEQTMPSKST SSHVKQSSNL
360 370 380 390 400
TANDLPPQGI LSQDTSSQDM LFHDMTSQDM QSLDMLSQDT PSHAMPPQDI
410 420 430 440 450
PSQDMLSQAL SAHAILPEAS TSHIVQFPEI QHLLQQPPDL QPENTEPQNQ
460 470 480 490 500
QILQMSYQDI RSEVMEETKE WKSEEELHRR KSSRRHSLNQ QTKALQYLRR
510 520 530 540 550
HSLDVQAKGQ KSSKRHSLDQ QSKGWQSPKQ KSLDQQIKDW LSPKRHSVDK
560 570 580 590 600
QAQLNQTKEQ LPDQQAEDQQ AKGEQYPEGQ SKDGQVKDQQ TDKEQNSKKQ
610 620 630 640 650
TQDQQTEDQP AQEKKSPKGQ FQNVQAEGQQ AQVEKVPKLL CQDSESQIQQ
660 670
YQFWQFHKGN LQAGQPRTVN LLAKNPLTG
Length:679
Mass (Da):76,580
Last modified:May 18, 2010 - v2
Checksum:iBD523CE5C28E1207
GO
Isoform 2 (identifier: Q96JA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     90-106: Missing.

Show »
Length:662
Mass (Da):74,658
Checksum:i92F73E6A55A1D08B
GO
Isoform 3 (identifier: Q96JA4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     157-170: VLFFLPSDVTQNSE → DFILLTPPHSSHFL
     171-679: Missing.

Show »
Length:58
Mass (Da):6,710
Checksum:iB33AEBC4EF01BFA0
GO
Isoform 4 (identifier: Q96JA4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-156: I → IGILLILLIISIAELSISVTIASFRSKCWTQSDE

Show »
Length:712
Mass (Da):80,183
Checksum:iF175A1F6A04D9910
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_039330177N → Y2 PublicationsCorresponds to variant dbSNP:rs7131283Ensembl.1
Natural variantiVAR_039331584G → R3 PublicationsCorresponds to variant dbSNP:rs3825020Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0317791 – 112Missing in isoform 3. IBD:Add BLAST112
Alternative sequenceiVSP_03178090 – 106Missing in isoform 2. IBD:Add BLAST17
Alternative sequenceiVSP_056734156I → IGILLILLIISIAELSISVT IASFRSKCWTQSDE in isoform 4. IKR:1
Alternative sequenceiVSP_031781157 – 170VLFFL…TQNSE → DFILLTPPHSSHFL in isoform 3. IBD:Add BLAST14
Alternative sequenceiVSP_031782171 – 679Missing in isoform 3. IBD:Add BLAST509

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF367473 mRNA. Translation: AAK53409.2.
AY094610 mRNA. Translation: AAM48587.1.
AY094611 mRNA. Translation: AAM48588.1.
AY584610 mRNA. Translation: AAV91959.1.
AP003127 Genomic DNA. No translation available.
BC107431 mRNA. Translation: AAI07432.1.
AL137391 mRNA. Translation: CAB70719.1.
CCDSiCCDS31569.1. [Q96JA4-1]
CCDS41652.1. [Q96JA4-2]
CCDS58136.1. [Q96JA4-5]
PIRiT46450.
RefSeqiNP_001073160.1. NM_001079692.2. [Q96JA4-2]
NP_001248757.1. NM_001261828.1. [Q96JA4-5]
NP_115986.3. NM_032597.4. [Q96JA4-1]
UniGeneiHs.709736.

Genome annotation databases

EnsembliENST00000300187; ENSP00000300187; ENSG00000166928. [Q96JA4-1]
ENST00000395005; ENSP00000378453; ENSG00000166928. [Q96JA4-2]
ENST00000531783; ENSP00000433761; ENSG00000166928. [Q96JA4-5]
GeneIDi84689.
KEGGihsa:84689.
UCSCiuc001npj.4. human. [Q96JA4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiM4A14_HUMAN
AccessioniPrimary (citable) accession number: Q96JA4
Secondary accession number(s): E9PJE3
, Q2TVT5, Q3B7W3, Q86XH8, Q9NTC2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: May 18, 2010
Last modified: November 22, 2017
This is version 106 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families