Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JA4

- M4A14_HUMAN

UniProt

Q96JA4 - M4A14_HUMAN

Protein

Membrane-spanning 4-domains subfamily A member 14

Gene

MS4A14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 82 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in signal transduction as a component of a multimeric receptor complex.By similarity

    Keywords - Molecular functioni

    Receptor

    Protein family/group databases

    TCDBi1.A.37.3.1. the cd20 ca(2+) channel (cd20) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Membrane-spanning 4-domains subfamily A member 14
    Alternative name(s):
    Testis development protein NYD-SP21
    Gene namesi
    Name:MS4A14
    Synonyms:MS4A13, MS4A16
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:30706. MS4A14.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162396237.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 679679Membrane-spanning 4-domains subfamily A member 14PRO_0000320967Add
    BLAST

    Proteomic databases

    PaxDbiQ96JA4.
    PRIDEiQ96JA4.

    PTM databases

    PhosphoSiteiQ96JA4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96JA4.
    BgeeiQ96JA4.
    CleanExiHS_MS4A13.
    HS_MS4A14.
    GenevestigatoriQ96JA4.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000300187.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96JA4.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei50 – 7021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei76 – 9621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei110 – 13021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei141 – 16121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi426 – 665240Gln-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MS4A family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG41161.
    HOGENOMiHOG000168377.
    HOVERGENiHBG067611.
    InParanoidiQ96JA4.
    OMAiFNGANVI.
    PhylomeDBiQ96JA4.
    TreeFamiTF337098.

    Family and domain databases

    InterProiIPR007237. CD20-like.
    [Graphical view]
    PfamiPF04103. CD20. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JA4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESTSQDRRA THVITIKPNE TVLTAFPYRP HSSLLDFLKG EPRVLGATQI    50
    LLALIIVGFG TIFALNYIGF SQRLPLVVLT GYPFWGALIF ILTGYLTVTD 100
    KKSKLLGQGV TGMNVISSLV AITGITFTIL SYRHQDKYCQ MPSFEEICVF 150
    SRTLFIVLFF LPSDVTQNSE QPAPEENDQL QFVLQEEFSS DDSTTNAQSV 200
    IFGGYAFFKL TLSRSPLVSQ PGNKGREFVP DEQKQSILPS PKFSEEEIEP 250
    LPPTLEKKPS ENMSIQLDST FKQMKDEDLQ SAIVQPSQMQ TKLLQDQAAS 300
    LQVFPSHSAL KLEDISPEDL PSQALPVEGL SEQTMPSKST SSHVKQSSNL 350
    TANDLPPQGI LSQDTSSQDM LFHDMTSQDM QSLDMLSQDT PSHAMPPQDI 400
    PSQDMLSQAL SAHAILPEAS TSHIVQFPEI QHLLQQPPDL QPENTEPQNQ 450
    QILQMSYQDI RSEVMEETKE WKSEEELHRR KSSRRHSLNQ QTKALQYLRR 500
    HSLDVQAKGQ KSSKRHSLDQ QSKGWQSPKQ KSLDQQIKDW LSPKRHSVDK 550
    QAQLNQTKEQ LPDQQAEDQQ AKGEQYPEGQ SKDGQVKDQQ TDKEQNSKKQ 600
    TQDQQTEDQP AQEKKSPKGQ FQNVQAEGQQ AQVEKVPKLL CQDSESQIQQ 650
    YQFWQFHKGN LQAGQPRTVN LLAKNPLTG 679
    Length:679
    Mass (Da):76,580
    Last modified:May 18, 2010 - v2
    Checksum:iBD523CE5C28E1207
    GO
    Isoform 2 (identifier: Q96JA4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         90-106: Missing.

    Show »
    Length:662
    Mass (Da):74,658
    Checksum:i92F73E6A55A1D08B
    GO
    Isoform 3 (identifier: Q96JA4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-112: Missing.
         157-170: VLFFLPSDVTQNSE → DFILLTPPHSSHFL
         171-679: Missing.

    Show »
    Length:58
    Mass (Da):6,710
    Checksum:iB33AEBC4EF01BFA0
    GO
    Isoform 4 (identifier: Q96JA4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         156-156: I → IGILLILLIISIAELSISVTIASFRSKCWTQSDE

    Show »
    Length:712
    Mass (Da):80,183
    Checksum:iF175A1F6A04D9910
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti177 – 1771N → Y.2 Publications
    Corresponds to variant rs7131283 [ dbSNP | Ensembl ].
    VAR_039330
    Natural varianti584 – 5841G → R.3 Publications
    Corresponds to variant rs3825020 [ dbSNP | Ensembl ].
    VAR_039331

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 112112Missing in isoform 3. 1 PublicationVSP_031779Add
    BLAST
    Alternative sequencei90 – 10617Missing in isoform 2. 1 PublicationVSP_031780Add
    BLAST
    Alternative sequencei156 – 1561I → IGILLILLIISIAELSISVT IASFRSKCWTQSDE in isoform 4. CuratedVSP_056734
    Alternative sequencei157 – 17014VLFFL…TQNSE → DFILLTPPHSSHFL in isoform 3. 1 PublicationVSP_031781Add
    BLAST
    Alternative sequencei171 – 679509Missing in isoform 3. 1 PublicationVSP_031782Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF367473 mRNA. Translation: AAK53409.2.
    AY094610 mRNA. Translation: AAM48587.1.
    AY094611 mRNA. Translation: AAM48588.1.
    AY584610 mRNA. Translation: AAV91959.1.
    AP003127 Genomic DNA. No translation available.
    BC107431 mRNA. Translation: AAI07432.1.
    AL137391 mRNA. Translation: CAB70719.1.
    CCDSiCCDS31569.1. [Q96JA4-1]
    CCDS41652.1. [Q96JA4-2]
    PIRiT46450.
    RefSeqiNP_001073160.1. NM_001079692.2. [Q96JA4-2]
    NP_001248757.1. NM_001261828.1.
    NP_115986.3. NM_032597.4. [Q96JA4-1]
    UniGeneiHs.709736.

    Genome annotation databases

    EnsembliENST00000300187; ENSP00000300187; ENSG00000166928. [Q96JA4-1]
    ENST00000395001; ENSP00000378449; ENSG00000166928. [Q96JA4-4]
    ENST00000395005; ENSP00000378453; ENSG00000166928. [Q96JA4-2]
    ENST00000531783; ENSP00000433761; ENSG00000166928.
    GeneIDi84689.
    KEGGihsa:84689.
    UCSCiuc001npi.3. human. [Q96JA4-1]
    uc001npk.3. human. [Q96JA4-2]
    uc031qbd.1. human.

    Polymorphism databases

    DMDMi296434579.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF367473 mRNA. Translation: AAK53409.2 .
    AY094610 mRNA. Translation: AAM48587.1 .
    AY094611 mRNA. Translation: AAM48588.1 .
    AY584610 mRNA. Translation: AAV91959.1 .
    AP003127 Genomic DNA. No translation available.
    BC107431 mRNA. Translation: AAI07432.1 .
    AL137391 mRNA. Translation: CAB70719.1 .
    CCDSi CCDS31569.1. [Q96JA4-1 ]
    CCDS41652.1. [Q96JA4-2 ]
    PIRi T46450.
    RefSeqi NP_001073160.1. NM_001079692.2. [Q96JA4-2 ]
    NP_001248757.1. NM_001261828.1.
    NP_115986.3. NM_032597.4. [Q96JA4-1 ]
    UniGenei Hs.709736.

    3D structure databases

    ProteinModelPortali Q96JA4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000300187.

    Protein family/group databases

    TCDBi 1.A.37.3.1. the cd20 ca(2+) channel (cd20) family.

    PTM databases

    PhosphoSitei Q96JA4.

    Polymorphism databases

    DMDMi 296434579.

    Proteomic databases

    PaxDbi Q96JA4.
    PRIDEi Q96JA4.

    Protocols and materials databases

    DNASUi 84689.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000300187 ; ENSP00000300187 ; ENSG00000166928 . [Q96JA4-1 ]
    ENST00000395001 ; ENSP00000378449 ; ENSG00000166928 . [Q96JA4-4 ]
    ENST00000395005 ; ENSP00000378453 ; ENSG00000166928 . [Q96JA4-2 ]
    ENST00000531783 ; ENSP00000433761 ; ENSG00000166928 .
    GeneIDi 84689.
    KEGGi hsa:84689.
    UCSCi uc001npi.3. human. [Q96JA4-1 ]
    uc001npk.3. human. [Q96JA4-2 ]
    uc031qbd.1. human.

    Organism-specific databases

    CTDi 84689.
    GeneCardsi GC11P060163.
    HGNCi HGNC:30706. MS4A14.
    neXtProti NX_Q96JA4.
    PharmGKBi PA162396237.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG41161.
    HOGENOMi HOG000168377.
    HOVERGENi HBG067611.
    InParanoidi Q96JA4.
    OMAi FNGANVI.
    PhylomeDBi Q96JA4.
    TreeFami TF337098.

    Miscellaneous databases

    GenomeRNAii 84689.
    NextBioi 74744.
    PROi Q96JA4.

    Gene expression databases

    ArrayExpressi Q96JA4.
    Bgeei Q96JA4.
    CleanExi HS_MS4A13.
    HS_MS4A14.
    Genevestigatori Q96JA4.

    Family and domain databases

    InterProi IPR007237. CD20-like.
    [Graphical view ]
    Pfami PF04103. CD20. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A new testis development gene NYD-SP21 from human testes."
      Li J.M., Sha J.H., Zhou Z.M.
      Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS TYR-177 AND ARG-584.
      Tissue: Testis.
    2. "MS4A genes."
      Liang Y., Tedder T.F.
      Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS TYR-177 AND ARG-584.
      Tissue: Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 191-679 (ISOFORMS 1/2), VARIANT ARG-584.
      Tissue: Testis.

    Entry informationi

    Entry nameiM4A14_HUMAN
    AccessioniPrimary (citable) accession number: Q96JA4
    Secondary accession number(s): E9PJE3
    , Q2TVT5, Q3B7W3, Q86XH8, Q9NTC2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 82 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3