Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JA4

- M4A14_HUMAN

UniProt

Q96JA4 - M4A14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Membrane-spanning 4-domains subfamily A member 14

Gene

MS4A14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

May be involved in signal transduction as a component of a multimeric receptor complex.By similarity

Keywords - Molecular functioni

Receptor

Protein family/group databases

TCDBi1.A.37.3.1. the cd20 ca(2+) channel (cd20) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Membrane-spanning 4-domains subfamily A member 14
Alternative name(s):
Testis development protein NYD-SP21
Gene namesi
Name:MS4A14
Synonyms:MS4A13, MS4A16
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:30706. MS4A14.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162396237.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 679679Membrane-spanning 4-domains subfamily A member 14PRO_0000320967Add
BLAST

Proteomic databases

PaxDbiQ96JA4.
PRIDEiQ96JA4.

PTM databases

PhosphoSiteiQ96JA4.

Expressioni

Gene expression databases

BgeeiQ96JA4.
CleanExiHS_MS4A13.
HS_MS4A14.
ExpressionAtlasiQ96JA4. baseline and differential.
GenevestigatoriQ96JA4.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000300187.

Structurei

3D structure databases

ProteinModelPortaliQ96JA4.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei50 – 7021HelicalSequence AnalysisAdd
BLAST
Transmembranei76 – 9621HelicalSequence AnalysisAdd
BLAST
Transmembranei110 – 13021HelicalSequence AnalysisAdd
BLAST
Transmembranei141 – 16121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi426 – 665240Gln-richAdd
BLAST

Sequence similaritiesi

Belongs to the MS4A family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG41161.
GeneTreeiENSGT00730000111143.
HOGENOMiHOG000168377.
HOVERGENiHBG067611.
InParanoidiQ96JA4.
OMAiFNGANVI.
PhylomeDBiQ96JA4.
TreeFamiTF337098.

Family and domain databases

InterProiIPR007237. CD20-like.
[Graphical view]
PfamiPF04103. CD20. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JA4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESTSQDRRA THVITIKPNE TVLTAFPYRP HSSLLDFLKG EPRVLGATQI
60 70 80 90 100
LLALIIVGFG TIFALNYIGF SQRLPLVVLT GYPFWGALIF ILTGYLTVTD
110 120 130 140 150
KKSKLLGQGV TGMNVISSLV AITGITFTIL SYRHQDKYCQ MPSFEEICVF
160 170 180 190 200
SRTLFIVLFF LPSDVTQNSE QPAPEENDQL QFVLQEEFSS DDSTTNAQSV
210 220 230 240 250
IFGGYAFFKL TLSRSPLVSQ PGNKGREFVP DEQKQSILPS PKFSEEEIEP
260 270 280 290 300
LPPTLEKKPS ENMSIQLDST FKQMKDEDLQ SAIVQPSQMQ TKLLQDQAAS
310 320 330 340 350
LQVFPSHSAL KLEDISPEDL PSQALPVEGL SEQTMPSKST SSHVKQSSNL
360 370 380 390 400
TANDLPPQGI LSQDTSSQDM LFHDMTSQDM QSLDMLSQDT PSHAMPPQDI
410 420 430 440 450
PSQDMLSQAL SAHAILPEAS TSHIVQFPEI QHLLQQPPDL QPENTEPQNQ
460 470 480 490 500
QILQMSYQDI RSEVMEETKE WKSEEELHRR KSSRRHSLNQ QTKALQYLRR
510 520 530 540 550
HSLDVQAKGQ KSSKRHSLDQ QSKGWQSPKQ KSLDQQIKDW LSPKRHSVDK
560 570 580 590 600
QAQLNQTKEQ LPDQQAEDQQ AKGEQYPEGQ SKDGQVKDQQ TDKEQNSKKQ
610 620 630 640 650
TQDQQTEDQP AQEKKSPKGQ FQNVQAEGQQ AQVEKVPKLL CQDSESQIQQ
660 670
YQFWQFHKGN LQAGQPRTVN LLAKNPLTG
Length:679
Mass (Da):76,580
Last modified:May 18, 2010 - v2
Checksum:iBD523CE5C28E1207
GO
Isoform 2 (identifier: Q96JA4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     90-106: Missing.

Show »
Length:662
Mass (Da):74,658
Checksum:i92F73E6A55A1D08B
GO
Isoform 3 (identifier: Q96JA4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-112: Missing.
     157-170: VLFFLPSDVTQNSE → DFILLTPPHSSHFL
     171-679: Missing.

Show »
Length:58
Mass (Da):6,710
Checksum:iB33AEBC4EF01BFA0
GO
Isoform 4 (identifier: Q96JA4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     156-156: I → IGILLILLIISIAELSISVTIASFRSKCWTQSDE

Show »
Length:712
Mass (Da):80,183
Checksum:iF175A1F6A04D9910
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti177 – 1771N → Y.2 Publications
Corresponds to variant rs7131283 [ dbSNP | Ensembl ].
VAR_039330
Natural varianti584 – 5841G → R.3 Publications
Corresponds to variant rs3825020 [ dbSNP | Ensembl ].
VAR_039331

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 112112Missing in isoform 3. 1 PublicationVSP_031779Add
BLAST
Alternative sequencei90 – 10617Missing in isoform 2. 1 PublicationVSP_031780Add
BLAST
Alternative sequencei156 – 1561I → IGILLILLIISIAELSISVT IASFRSKCWTQSDE in isoform 4. CuratedVSP_056734
Alternative sequencei157 – 17014VLFFL…TQNSE → DFILLTPPHSSHFL in isoform 3. 1 PublicationVSP_031781Add
BLAST
Alternative sequencei171 – 679509Missing in isoform 3. 1 PublicationVSP_031782Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF367473 mRNA. Translation: AAK53409.2.
AY094610 mRNA. Translation: AAM48587.1.
AY094611 mRNA. Translation: AAM48588.1.
AY584610 mRNA. Translation: AAV91959.1.
AP003127 Genomic DNA. No translation available.
BC107431 mRNA. Translation: AAI07432.1.
AL137391 mRNA. Translation: CAB70719.1.
CCDSiCCDS31569.1. [Q96JA4-1]
CCDS41652.1. [Q96JA4-2]
PIRiT46450.
RefSeqiNP_001073160.1. NM_001079692.2. [Q96JA4-2]
NP_001248757.1. NM_001261828.1.
NP_115986.3. NM_032597.4. [Q96JA4-1]
UniGeneiHs.709736.

Genome annotation databases

EnsembliENST00000300187; ENSP00000300187; ENSG00000166928. [Q96JA4-1]
ENST00000395005; ENSP00000378453; ENSG00000166928. [Q96JA4-2]
ENST00000531783; ENSP00000433761; ENSG00000166928. [Q96JA4-5]
GeneIDi84689.
KEGGihsa:84689.
UCSCiuc001npi.3. human. [Q96JA4-1]
uc001npk.3. human. [Q96JA4-2]

Polymorphism databases

DMDMi296434579.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF367473 mRNA. Translation: AAK53409.2 .
AY094610 mRNA. Translation: AAM48587.1 .
AY094611 mRNA. Translation: AAM48588.1 .
AY584610 mRNA. Translation: AAV91959.1 .
AP003127 Genomic DNA. No translation available.
BC107431 mRNA. Translation: AAI07432.1 .
AL137391 mRNA. Translation: CAB70719.1 .
CCDSi CCDS31569.1. [Q96JA4-1 ]
CCDS41652.1. [Q96JA4-2 ]
PIRi T46450.
RefSeqi NP_001073160.1. NM_001079692.2. [Q96JA4-2 ]
NP_001248757.1. NM_001261828.1.
NP_115986.3. NM_032597.4. [Q96JA4-1 ]
UniGenei Hs.709736.

3D structure databases

ProteinModelPortali Q96JA4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000300187.

Protein family/group databases

TCDBi 1.A.37.3.1. the cd20 ca(2+) channel (cd20) family.

PTM databases

PhosphoSitei Q96JA4.

Polymorphism databases

DMDMi 296434579.

Proteomic databases

PaxDbi Q96JA4.
PRIDEi Q96JA4.

Protocols and materials databases

DNASUi 84689.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000300187 ; ENSP00000300187 ; ENSG00000166928 . [Q96JA4-1 ]
ENST00000395005 ; ENSP00000378453 ; ENSG00000166928 . [Q96JA4-2 ]
ENST00000531783 ; ENSP00000433761 ; ENSG00000166928 . [Q96JA4-5 ]
GeneIDi 84689.
KEGGi hsa:84689.
UCSCi uc001npi.3. human. [Q96JA4-1 ]
uc001npk.3. human. [Q96JA4-2 ]

Organism-specific databases

CTDi 84689.
GeneCardsi GC11P060163.
HGNCi HGNC:30706. MS4A14.
neXtProti NX_Q96JA4.
PharmGKBi PA162396237.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG41161.
GeneTreei ENSGT00730000111143.
HOGENOMi HOG000168377.
HOVERGENi HBG067611.
InParanoidi Q96JA4.
OMAi FNGANVI.
PhylomeDBi Q96JA4.
TreeFami TF337098.

Miscellaneous databases

GenomeRNAii 84689.
NextBioi 74744.
PROi Q96JA4.

Gene expression databases

Bgeei Q96JA4.
CleanExi HS_MS4A13.
HS_MS4A14.
ExpressionAtlasi Q96JA4. baseline and differential.
Genevestigatori Q96JA4.

Family and domain databases

InterProi IPR007237. CD20-like.
[Graphical view ]
Pfami PF04103. CD20. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A new testis development gene NYD-SP21 from human testes."
    Li J.M., Sha J.H., Zhou Z.M.
    Submitted (AUG-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS TYR-177 AND ARG-584.
    Tissue: Testis.
  2. "MS4A genes."
    Liang Y., Tedder T.F.
    Submitted (APR-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANTS TYR-177 AND ARG-584.
    Tissue: Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 191-679 (ISOFORMS 1/2), VARIANT ARG-584.
    Tissue: Testis.

Entry informationi

Entry nameiM4A14_HUMAN
AccessioniPrimary (citable) accession number: Q96JA4
Secondary accession number(s): E9PJE3
, Q2TVT5, Q3B7W3, Q86XH8, Q9NTC2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3