Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96JA1

- LRIG1_HUMAN

UniProt

Q96JA1 - LRIG1_HUMAN

Protein

Leucine-rich repeats and immunoglobulin-like domains protein 1

Gene

LRIG1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 2 (03 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.1 Publication

    Enzyme and pathway databases

    ReactomeiREACT_9417. Signaling by EGFR.
    SignaLinkiQ96JA1.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Leucine-rich repeats and immunoglobulin-like domains protein 1
    Short name:
    LIG-1
    Gene namesi
    Name:LRIG1
    Synonyms:LIG1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:17360. LRIG1.

    Subcellular locationi

    Membrane 1 Publication; Single-pass type I membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38450.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3434Sequence AnalysisAdd
    BLAST
    Chaini35 – 10931059Leucine-rich repeats and immunoglobulin-like domains protein 1PRO_0000014827Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi74 – 741N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi150 – 1501N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi246 – 2461N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi292 – 2921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi318 – 3181N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
    Disulfide bondi620 ↔ 672PROSITE-ProRule annotation
    Glycosylationi684 – 6841N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi714 ↔ 763PROSITE-ProRule annotation

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    MaxQBiQ96JA1.
    PaxDbiQ96JA1.
    PRIDEiQ96JA1.

    PTM databases

    PhosphoSiteiQ96JA1.

    Expressioni

    Tissue specificityi

    Widely expressed.1 Publication

    Inductioni

    By EGF.1 Publication

    Gene expression databases

    BgeeiQ96JA1.
    CleanExiHS_LIG1.
    HS_LRIG1.
    GenevestigatoriQ96JA1.

    Organism-specific databases

    HPAiHPA011846.

    Interactioni

    Subunit structurei

    Interacts with EGFR/ERBB1, ERBB2, ERBB3 and ERBB4.1 Publication

    Protein-protein interaction databases

    BioGridi117489. 11 interactions.
    IntActiQ96JA1. 1 interaction.
    STRINGi9606.ENSP00000273261.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96JA1.
    SMRiQ96JA1. Positions 36-811.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini35 – 794760ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini816 – 1093278CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei795 – 81521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini35 – 6834LRRNTAdd
    BLAST
    Repeati69 – 9022LRR 1Add
    BLAST
    Repeati93 – 11422LRR 2Add
    BLAST
    Repeati116 – 13722LRR 3Add
    BLAST
    Repeati140 – 16122LRR 4Add
    BLAST
    Repeati164 – 18522LRR 5Add
    BLAST
    Repeati189 – 21022LRR 6Add
    BLAST
    Repeati212 – 23322LRR 7Add
    BLAST
    Repeati236 – 25722LRR 8Add
    BLAST
    Repeati260 – 28122LRR 9Add
    BLAST
    Repeati284 – 30522LRR 10Add
    BLAST
    Repeati308 – 32922LRR 11Add
    BLAST
    Repeati332 – 35322LRR 12Add
    BLAST
    Repeati356 – 37823LRR 13Add
    BLAST
    Repeati383 – 40422LRR 14Add
    BLAST
    Repeati407 – 42822LRR 15Add
    BLAST
    Domaini440 – 49152LRRCTAdd
    BLAST
    Domaini495 – 594100Ig-like C2-type 1Add
    BLAST
    Domaini599 – 68890Ig-like C2-type 2Add
    BLAST
    Domaini693 – 77987Ig-like C2-type 3Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi520 – 5245Poly-Ser

    Domaini

    The LRRs and the Ig-domains are each sufficient for EGFR/ERBB1 binding. This interaction is abolished only when these two domains are deleted.

    Sequence similaritiesi

    Contains 15 LRR (leucine-rich) repeats.Curated
    Contains 1 LRRCT domain.Curated
    Contains 1 LRRNT domain.Curated

    Keywords - Domaini

    Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG4886.
    HOGENOMiHOG000113380.
    HOVERGENiHBG052353.
    InParanoidiQ96JA1.
    OMAiESNGVCP.
    OrthoDBiEOG7DNNTD.
    PhylomeDBiQ96JA1.
    TreeFamiTF325380.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    [Graphical view]
    PfamiPF07679. I-set. 3 hits.
    PF13855. LRR_8. 5 hits.
    PF01463. LRRCT. 1 hit.
    [Graphical view]
    SMARTiSM00409. IG. 1 hit.
    SM00408. IGc2. 2 hits.
    SM00369. LRR_TYP. 2 hits.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    [Graphical view]
    PROSITEiPS50835. IG_LIKE. 3 hits.
    PS51450. LRR. 14 hits.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96JA1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MARPVRGGLG APRRSPCLLL LWLLLLRLEP VTAAAGPRAP CAAACTCAGD     50
    SLDCGGRGLA ALPGDLPSWT RSLNLSYNKL SEIDPAGFED LPNLQEVYLN 100
    NNELTAVPSL GAASSHVVSL FLQHNKIRSV EGSQLKAYLS LEVLDLSLNN 150
    ITEVRNTCFP HGPPIKELNL AGNRIGTLEL GAFDGLSRSL LTLRLSKNRI 200
    TQLPVRAFKL PRLTQLDLNR NRIRLIEGLT FQGLNSLEVL KLQRNNISKL 250
    TDGAFWGLSK MHVLHLEYNS LVEVNSGSLY GLTALHQLHL SNNSIARIHR 300
    KGWSFCQKLH ELVLSFNNLT RLDEESLAEL SSLSVLRLSH NSISHIAEGA 350
    FKGLRSLRVL DLDHNEISGT IEDTSGAFSG LDSLSKLTLF GNKIKSVAKR 400
    AFSGLEGLEH LNLGGNAIRS VQFDAFVKMK NLKELHISSD SFLCDCQLKW 450
    LPPWLIGRML QAFVTATCAH PESLKGQSIF SVPPESFVCD DFLKPQIITQ 500
    PETTMAMVGK DIRFTCSAAS SSSSPMTFAW KKDNEVLTNA DMENFVHVHA 550
    QDGEVMEYTT ILHLRQVTFG HEGRYQCVIT NHFGSTYSHK ARLTVNVLPS 600
    FTKTPHDITI RTTTMARLEC AATGHPNPQI AWQKDGGTDF PAARERRMHV 650
    MPDDDVFFIT DVKIDDAGVY SCTAQNSAGS ISANATLTVL ETPSLVVPLE 700
    DRVVSVGETV ALQCKATGNP PPRITWFKGD RPLSLTERHH LTPDNQLLVV 750
    QNVVAEDAGR YTCEMSNTLG TERAHSQLSV LPAAGCRKDG TTVGIFTIAV 800
    VSSIVLTSLV WVCIIYQTRK KSEEYSVTNT DETVVPPDVP SYLSSQGTLS 850
    DRQETVVRTE GGPQANGHIE SNGVCPRDAS HFPEPDTHSV ACRQPKLCAG 900
    SAYHKEPWKA MEKAEGTPGP HKMEHGGRVV CSDCNTEVDC YSRGQAFHPQ 950
    PVSRDSAQPS APNGPEPGGS DQEHSPHHQC SRTAAGSCPE CQGSLYPSNH 1000
    DRMLTAVKKK PMASLDGKGD SSWTLARLYH PDSTELQPAS SLTSGSPERA 1050
    EAQYLLVSNG HLPKACDASP ESTPLTGQLP GKQRVPLLLA PKS 1093
    Length:1,093
    Mass (Da):119,113
    Last modified:April 3, 2007 - v2
    Checksum:i7B4F13CA343AF943
    GO
    Isoform 2 (identifier: Q96JA1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         387-387: L → LLLLEPSQSAGCSSPSQPHMSAGGR
         644-691: RERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLE → Q

    Show »
    Length:1,070
    Mass (Da):116,378
    Checksum:i3EDFDDF0C1319D67
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti24 – 263LLL → VLV in AAK62357. (PubMed:11414704)Curated
    Sequence conflicti24 – 263LLL → VLV in AAH71561. (PubMed:15489334)Curated
    Sequence conflicti80 – 801L → F in AAH71561. (PubMed:15489334)Curated
    Sequence conflicti612 – 6132TT → VR in CAB56036. (PubMed:17974005)Curated
    Sequence conflicti861 – 8611G → GA in BAB40659. 1 PublicationCurated
    Sequence conflicti911 – 9111M → I in BAB40659. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti24 – 241L → V.
    Corresponds to variant rs1403626 [ dbSNP | Ensembl ].
    VAR_049889
    Natural varianti615 – 6151M → V.2 Publications
    Corresponds to variant rs2306272 [ dbSNP | Ensembl ].
    VAR_031581
    Natural varianti926 – 9261G → S.
    Corresponds to variant rs9877201 [ dbSNP | Ensembl ].
    VAR_031582
    Natural varianti957 – 9571A → T.
    Corresponds to variant rs332373 [ dbSNP | Ensembl ].
    VAR_031583
    Natural varianti993 – 9931G → A.
    Corresponds to variant rs2279289 [ dbSNP | Ensembl ].
    VAR_049890
    Natural varianti1031 – 10311P → R.
    Corresponds to variant rs332374 [ dbSNP | Ensembl ].
    VAR_031584
    Natural varianti1053 – 10531Q → P.
    Corresponds to variant rs2279290 [ dbSNP | Ensembl ].
    VAR_031585

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei387 – 3871L → LLLLEPSQSAGCSSPSQPHM SAGGR in isoform 2. 1 PublicationVSP_011730
    Alternative sequencei644 – 69148RERRM…LTVLE → Q in isoform 2. 1 PublicationVSP_011731Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF381545 mRNA. Translation: AAK62357.1.
    AB050468 mRNA. Translation: BAB40659.1.
    BC071561 mRNA. Translation: AAH71561.1.
    BC014276 mRNA. Translation: AAH14276.2.
    AL117666 mRNA. Translation: CAB56036.1.
    CCDSiCCDS33783.1. [Q96JA1-1]
    PIRiT17346.
    RefSeqiNP_056356.2. NM_015541.2. [Q96JA1-1]
    UniGeneiHs.518055.

    Genome annotation databases

    EnsembliENST00000273261; ENSP00000273261; ENSG00000144749. [Q96JA1-1]
    ENST00000383703; ENSP00000373208; ENSG00000144749. [Q96JA1-2]
    GeneIDi26018.
    KEGGihsa:26018.
    UCSCiuc003dmw.3. human. [Q96JA1-1]
    uc010hoa.3. human. [Q96JA1-2]

    Polymorphism databases

    DMDMi143811415.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF381545 mRNA. Translation: AAK62357.1 .
    AB050468 mRNA. Translation: BAB40659.1 .
    BC071561 mRNA. Translation: AAH71561.1 .
    BC014276 mRNA. Translation: AAH14276.2 .
    AL117666 mRNA. Translation: CAB56036.1 .
    CCDSi CCDS33783.1. [Q96JA1-1 ]
    PIRi T17346.
    RefSeqi NP_056356.2. NM_015541.2. [Q96JA1-1 ]
    UniGenei Hs.518055.

    3D structure databases

    ProteinModelPortali Q96JA1.
    SMRi Q96JA1. Positions 36-811.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117489. 11 interactions.
    IntActi Q96JA1. 1 interaction.
    STRINGi 9606.ENSP00000273261.

    PTM databases

    PhosphoSitei Q96JA1.

    Polymorphism databases

    DMDMi 143811415.

    Proteomic databases

    MaxQBi Q96JA1.
    PaxDbi Q96JA1.
    PRIDEi Q96JA1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000273261 ; ENSP00000273261 ; ENSG00000144749 . [Q96JA1-1 ]
    ENST00000383703 ; ENSP00000373208 ; ENSG00000144749 . [Q96JA1-2 ]
    GeneIDi 26018.
    KEGGi hsa:26018.
    UCSCi uc003dmw.3. human. [Q96JA1-1 ]
    uc010hoa.3. human. [Q96JA1-2 ]

    Organism-specific databases

    CTDi 26018.
    GeneCardsi GC03M066511.
    H-InvDB HIX0003431.
    HGNCi HGNC:17360. LRIG1.
    HPAi HPA011846.
    MIMi 608868. gene.
    neXtProti NX_Q96JA1.
    PharmGKBi PA38450.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4886.
    HOGENOMi HOG000113380.
    HOVERGENi HBG052353.
    InParanoidi Q96JA1.
    OMAi ESNGVCP.
    OrthoDBi EOG7DNNTD.
    PhylomeDBi Q96JA1.
    TreeFami TF325380.

    Enzyme and pathway databases

    Reactomei REACT_9417. Signaling by EGFR.
    SignaLinki Q96JA1.

    Miscellaneous databases

    ChiTaRSi LRIG1. human.
    GeneWikii LRIG1.
    GenomeRNAii 26018.
    NextBioi 47784.
    PROi Q96JA1.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q96JA1.
    CleanExi HS_LIG1.
    HS_LRIG1.
    Genevestigatori Q96JA1.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR000483. Cys-rich_flank_reg_C.
    IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR013098. Ig_I-set.
    IPR003599. Ig_sub.
    IPR003598. Ig_sub2.
    IPR001611. Leu-rich_rpt.
    IPR003591. Leu-rich_rpt_typical-subtyp.
    IPR000372. LRR-contain_N.
    [Graphical view ]
    Pfami PF07679. I-set. 3 hits.
    PF13855. LRR_8. 5 hits.
    PF01463. LRRCT. 1 hit.
    [Graphical view ]
    SMARTi SM00409. IG. 1 hit.
    SM00408. IGc2. 2 hits.
    SM00369. LRR_TYP. 2 hits.
    SM00082. LRRCT. 1 hit.
    SM00013. LRRNT. 1 hit.
    [Graphical view ]
    PROSITEi PS50835. IG_LIKE. 3 hits.
    PS51450. LRR. 14 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-615.
    2. "Human membrane glycoprotein LIG-1."
      Suzuki Y.
      Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Lymph and Placenta.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 611-1093, VARIANT VAL-615.
      Tissue: Uterus.
    5. "LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation."
      Gur G., Rubin C., Katz M., Amit I., Citri A., Nilsson J., Amariglio N., Henriksson R., Rechavi G., Hedman H., Wides R., Yarden Y.
      EMBO J. 23:3270-3281(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INDUCTION, INTERACTION WITH EGFR; ERBB2; ERBB3 AND ERBB4.

    Entry informationi

    Entry nameiLRIG1_HUMAN
    AccessioniPrimary (citable) accession number: Q96JA1
    Secondary accession number(s): Q6IQ51
    , Q96CF9, Q9BYB8, Q9UFI4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 11, 2004
    Last sequence update: April 3, 2007
    Last modified: October 1, 2014
    This is version 110 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3