Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JA1

- LRIG1_HUMAN

UniProt

Q96JA1 - LRIG1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Leucine-rich repeats and immunoglobulin-like domains protein 1

Gene

LRIG1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.1 Publication

GO - Biological processi

  1. innervation Source: Ensembl
  2. otolith morphogenesis Source: Ensembl
  3. sensory perception of sound Source: Ensembl
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_9417. Signaling by EGFR.
SignaLinkiQ96JA1.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeats and immunoglobulin-like domains protein 1
Short name:
LIG-1
Gene namesi
Name:LRIG1
Synonyms:LIG1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:17360. LRIG1.

Subcellular locationi

Membrane 1 Publication; Single-pass type I membrane protein 1 Publication

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38450.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3434Sequence AnalysisAdd
BLAST
Chaini35 – 10931059Leucine-rich repeats and immunoglobulin-like domains protein 1PRO_0000014827Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi74 – 741N-linked (GlcNAc...)Sequence Analysis
Glycosylationi150 – 1501N-linked (GlcNAc...)Sequence Analysis
Glycosylationi246 – 2461N-linked (GlcNAc...)Sequence Analysis
Glycosylationi292 – 2921N-linked (GlcNAc...)Sequence Analysis
Glycosylationi318 – 3181N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi516 ↔ 577PROSITE-ProRule annotation
Disulfide bondi620 ↔ 672PROSITE-ProRule annotation
Glycosylationi684 – 6841N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi714 ↔ 763PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ96JA1.
PaxDbiQ96JA1.
PRIDEiQ96JA1.

PTM databases

PhosphoSiteiQ96JA1.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Inductioni

By EGF.1 Publication

Gene expression databases

BgeeiQ96JA1.
CleanExiHS_LIG1.
HS_LRIG1.
GenevestigatoriQ96JA1.

Organism-specific databases

HPAiHPA011846.

Interactioni

Subunit structurei

Interacts with EGFR/ERBB1, ERBB2, ERBB3 and ERBB4.1 Publication

Protein-protein interaction databases

BioGridi117489. 17 interactions.
IntActiQ96JA1. 1 interaction.
STRINGi9606.ENSP00000273261.

Structurei

3D structure databases

ProteinModelPortaliQ96JA1.
SMRiQ96JA1. Positions 36-811.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 794760ExtracellularSequence AnalysisAdd
BLAST
Topological domaini816 – 1093278CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei795 – 81521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 6834LRRNTAdd
BLAST
Repeati69 – 9022LRR 1Add
BLAST
Repeati93 – 11422LRR 2Add
BLAST
Repeati116 – 13722LRR 3Add
BLAST
Repeati140 – 16122LRR 4Add
BLAST
Repeati164 – 18522LRR 5Add
BLAST
Repeati189 – 21022LRR 6Add
BLAST
Repeati212 – 23322LRR 7Add
BLAST
Repeati236 – 25722LRR 8Add
BLAST
Repeati260 – 28122LRR 9Add
BLAST
Repeati284 – 30522LRR 10Add
BLAST
Repeati308 – 32922LRR 11Add
BLAST
Repeati332 – 35322LRR 12Add
BLAST
Repeati356 – 37823LRR 13Add
BLAST
Repeati383 – 40422LRR 14Add
BLAST
Repeati407 – 42822LRR 15Add
BLAST
Domaini440 – 49152LRRCTAdd
BLAST
Domaini495 – 594100Ig-like C2-type 1Add
BLAST
Domaini599 – 68890Ig-like C2-type 2Add
BLAST
Domaini693 – 77987Ig-like C2-type 3Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi520 – 5245Poly-Ser

Domaini

The LRRs and the Ig-domains are each sufficient for EGFR/ERBB1 binding. This interaction is abolished only when these two domains are deleted.

Sequence similaritiesi

Contains 15 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated
Contains 1 LRRNT domain.Curated

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4886.
GeneTreeiENSGT00760000118777.
HOGENOMiHOG000113380.
HOVERGENiHBG052353.
InParanoidiQ96JA1.
OMAiESNGVCP.
OrthoDBiEOG7DNNTD.
PhylomeDBiQ96JA1.
TreeFamiTF325380.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
[Graphical view]
PfamiPF07679. I-set. 3 hits.
PF13855. LRR_8. 5 hits.
PF01463. LRRCT. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
SM00369. LRR_TYP. 2 hits.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 3 hits.
PS51450. LRR. 14 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JA1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MARPVRGGLG APRRSPCLLL LWLLLLRLEP VTAAAGPRAP CAAACTCAGD
60 70 80 90 100
SLDCGGRGLA ALPGDLPSWT RSLNLSYNKL SEIDPAGFED LPNLQEVYLN
110 120 130 140 150
NNELTAVPSL GAASSHVVSL FLQHNKIRSV EGSQLKAYLS LEVLDLSLNN
160 170 180 190 200
ITEVRNTCFP HGPPIKELNL AGNRIGTLEL GAFDGLSRSL LTLRLSKNRI
210 220 230 240 250
TQLPVRAFKL PRLTQLDLNR NRIRLIEGLT FQGLNSLEVL KLQRNNISKL
260 270 280 290 300
TDGAFWGLSK MHVLHLEYNS LVEVNSGSLY GLTALHQLHL SNNSIARIHR
310 320 330 340 350
KGWSFCQKLH ELVLSFNNLT RLDEESLAEL SSLSVLRLSH NSISHIAEGA
360 370 380 390 400
FKGLRSLRVL DLDHNEISGT IEDTSGAFSG LDSLSKLTLF GNKIKSVAKR
410 420 430 440 450
AFSGLEGLEH LNLGGNAIRS VQFDAFVKMK NLKELHISSD SFLCDCQLKW
460 470 480 490 500
LPPWLIGRML QAFVTATCAH PESLKGQSIF SVPPESFVCD DFLKPQIITQ
510 520 530 540 550
PETTMAMVGK DIRFTCSAAS SSSSPMTFAW KKDNEVLTNA DMENFVHVHA
560 570 580 590 600
QDGEVMEYTT ILHLRQVTFG HEGRYQCVIT NHFGSTYSHK ARLTVNVLPS
610 620 630 640 650
FTKTPHDITI RTTTMARLEC AATGHPNPQI AWQKDGGTDF PAARERRMHV
660 670 680 690 700
MPDDDVFFIT DVKIDDAGVY SCTAQNSAGS ISANATLTVL ETPSLVVPLE
710 720 730 740 750
DRVVSVGETV ALQCKATGNP PPRITWFKGD RPLSLTERHH LTPDNQLLVV
760 770 780 790 800
QNVVAEDAGR YTCEMSNTLG TERAHSQLSV LPAAGCRKDG TTVGIFTIAV
810 820 830 840 850
VSSIVLTSLV WVCIIYQTRK KSEEYSVTNT DETVVPPDVP SYLSSQGTLS
860 870 880 890 900
DRQETVVRTE GGPQANGHIE SNGVCPRDAS HFPEPDTHSV ACRQPKLCAG
910 920 930 940 950
SAYHKEPWKA MEKAEGTPGP HKMEHGGRVV CSDCNTEVDC YSRGQAFHPQ
960 970 980 990 1000
PVSRDSAQPS APNGPEPGGS DQEHSPHHQC SRTAAGSCPE CQGSLYPSNH
1010 1020 1030 1040 1050
DRMLTAVKKK PMASLDGKGD SSWTLARLYH PDSTELQPAS SLTSGSPERA
1060 1070 1080 1090
EAQYLLVSNG HLPKACDASP ESTPLTGQLP GKQRVPLLLA PKS
Length:1,093
Mass (Da):119,113
Last modified:April 3, 2007 - v2
Checksum:i7B4F13CA343AF943
GO
Isoform 2 (identifier: Q96JA1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-387: L → LLLLEPSQSAGCSSPSQPHMSAGGR
     644-691: RERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLE → Q

Show »
Length:1,070
Mass (Da):116,378
Checksum:i3EDFDDF0C1319D67
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti24 – 263LLL → VLV in AAK62357. (PubMed:11414704)Curated
Sequence conflicti24 – 263LLL → VLV in AAH71561. (PubMed:15489334)Curated
Sequence conflicti80 – 801L → F in AAH71561. (PubMed:15489334)Curated
Sequence conflicti612 – 6132TT → VR in CAB56036. (PubMed:17974005)Curated
Sequence conflicti861 – 8611G → GA in BAB40659. 1 PublicationCurated
Sequence conflicti911 – 9111M → I in BAB40659. 1 PublicationCurated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → V.
Corresponds to variant rs1403626 [ dbSNP | Ensembl ].
VAR_049889
Natural varianti615 – 6151M → V.2 Publications
Corresponds to variant rs2306272 [ dbSNP | Ensembl ].
VAR_031581
Natural varianti926 – 9261G → S.
Corresponds to variant rs9877201 [ dbSNP | Ensembl ].
VAR_031582
Natural varianti957 – 9571A → T.
Corresponds to variant rs332373 [ dbSNP | Ensembl ].
VAR_031583
Natural varianti993 – 9931G → A.
Corresponds to variant rs2279289 [ dbSNP | Ensembl ].
VAR_049890
Natural varianti1031 – 10311P → R.
Corresponds to variant rs332374 [ dbSNP | Ensembl ].
VAR_031584
Natural varianti1053 – 10531Q → P.
Corresponds to variant rs2279290 [ dbSNP | Ensembl ].
VAR_031585

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei387 – 3871L → LLLLEPSQSAGCSSPSQPHM SAGGR in isoform 2. 1 PublicationVSP_011730
Alternative sequencei644 – 69148RERRM…LTVLE → Q in isoform 2. 1 PublicationVSP_011731Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF381545 mRNA. Translation: AAK62357.1.
AB050468 mRNA. Translation: BAB40659.1.
BC071561 mRNA. Translation: AAH71561.1.
BC014276 mRNA. Translation: AAH14276.2.
AL117666 mRNA. Translation: CAB56036.1.
CCDSiCCDS33783.1. [Q96JA1-1]
PIRiT17346.
RefSeqiNP_056356.2. NM_015541.2. [Q96JA1-1]
UniGeneiHs.518055.

Genome annotation databases

EnsembliENST00000273261; ENSP00000273261; ENSG00000144749. [Q96JA1-1]
ENST00000383703; ENSP00000373208; ENSG00000144749. [Q96JA1-2]
GeneIDi26018.
KEGGihsa:26018.
UCSCiuc003dmw.3. human. [Q96JA1-1]
uc010hoa.3. human. [Q96JA1-2]

Polymorphism databases

DMDMi143811415.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF381545 mRNA. Translation: AAK62357.1 .
AB050468 mRNA. Translation: BAB40659.1 .
BC071561 mRNA. Translation: AAH71561.1 .
BC014276 mRNA. Translation: AAH14276.2 .
AL117666 mRNA. Translation: CAB56036.1 .
CCDSi CCDS33783.1. [Q96JA1-1 ]
PIRi T17346.
RefSeqi NP_056356.2. NM_015541.2. [Q96JA1-1 ]
UniGenei Hs.518055.

3D structure databases

ProteinModelPortali Q96JA1.
SMRi Q96JA1. Positions 36-811.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117489. 17 interactions.
IntActi Q96JA1. 1 interaction.
STRINGi 9606.ENSP00000273261.

PTM databases

PhosphoSitei Q96JA1.

Polymorphism databases

DMDMi 143811415.

Proteomic databases

MaxQBi Q96JA1.
PaxDbi Q96JA1.
PRIDEi Q96JA1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000273261 ; ENSP00000273261 ; ENSG00000144749 . [Q96JA1-1 ]
ENST00000383703 ; ENSP00000373208 ; ENSG00000144749 . [Q96JA1-2 ]
GeneIDi 26018.
KEGGi hsa:26018.
UCSCi uc003dmw.3. human. [Q96JA1-1 ]
uc010hoa.3. human. [Q96JA1-2 ]

Organism-specific databases

CTDi 26018.
GeneCardsi GC03M066429.
H-InvDB HIX0003431.
HGNCi HGNC:17360. LRIG1.
HPAi HPA011846.
MIMi 608868. gene.
neXtProti NX_Q96JA1.
PharmGKBi PA38450.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4886.
GeneTreei ENSGT00760000118777.
HOGENOMi HOG000113380.
HOVERGENi HBG052353.
InParanoidi Q96JA1.
OMAi ESNGVCP.
OrthoDBi EOG7DNNTD.
PhylomeDBi Q96JA1.
TreeFami TF325380.

Enzyme and pathway databases

Reactomei REACT_9417. Signaling by EGFR.
SignaLinki Q96JA1.

Miscellaneous databases

ChiTaRSi LRIG1. human.
GeneWikii LRIG1.
GenomeRNAii 26018.
NextBioi 47784.
PROi Q96JA1.
SOURCEi Search...

Gene expression databases

Bgeei Q96JA1.
CleanExi HS_LIG1.
HS_LRIG1.
Genevestigatori Q96JA1.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
[Graphical view ]
Pfami PF07679. I-set. 3 hits.
PF13855. LRR_8. 5 hits.
PF01463. LRRCT. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
SM00369. LRR_TYP. 2 hits.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 3 hits.
PS51450. LRR. 14 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-615.
  2. "Human membrane glycoprotein LIG-1."
    Suzuki Y.
    Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lymph and Placenta.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 611-1093, VARIANT VAL-615.
    Tissue: Uterus.
  5. "LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation."
    Gur G., Rubin C., Katz M., Amit I., Citri A., Nilsson J., Amariglio N., Henriksson R., Rechavi G., Hedman H., Wides R., Yarden Y.
    EMBO J. 23:3270-3281(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION, INTERACTION WITH EGFR; ERBB2; ERBB3 AND ERBB4.

Entry informationi

Entry nameiLRIG1_HUMAN
AccessioniPrimary (citable) accession number: Q96JA1
Secondary accession number(s): Q6IQ51
, Q96CF9, Q9BYB8, Q9UFI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: April 3, 2007
Last modified: October 29, 2014
This is version 111 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3