SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96JA1

- LRIG1_HUMAN

UniProt

Q96JA1 - LRIG1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Leucine-rich repeats and immunoglobulin-like domains protein 1
Gene
LRIG1, LIG1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation.1 Publication

Enzyme and pathway databases

ReactomeiREACT_9417. Signaling by EGFR.
SignaLinkiQ96JA1.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeats and immunoglobulin-like domains protein 1
Short name:
LIG-1
Gene namesi
Name:LRIG1
Synonyms:LIG1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:17360. LRIG1.

Subcellular locationi

Membrane; Single-pass type I membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini35 – 794760Extracellular Reviewed prediction
Add
BLAST
Transmembranei795 – 81521Helical; Reviewed prediction
Add
BLAST
Topological domaini816 – 1093278Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38450.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3434 Reviewed prediction
Add
BLAST
Chaini35 – 10931059Leucine-rich repeats and immunoglobulin-like domains protein 1
PRO_0000014827Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi74 – 741N-linked (GlcNAc...) Reviewed prediction
Glycosylationi150 – 1501N-linked (GlcNAc...) Reviewed prediction
Glycosylationi246 – 2461N-linked (GlcNAc...) Reviewed prediction
Glycosylationi292 – 2921N-linked (GlcNAc...) Reviewed prediction
Glycosylationi318 – 3181N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi516 ↔ 577 By similarity
Disulfide bondi620 ↔ 672 By similarity
Glycosylationi684 – 6841N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi714 ↔ 763 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ96JA1.
PaxDbiQ96JA1.
PRIDEiQ96JA1.

PTM databases

PhosphoSiteiQ96JA1.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Inductioni

By EGF.1 Publication

Gene expression databases

BgeeiQ96JA1.
CleanExiHS_LIG1.
HS_LRIG1.
GenevestigatoriQ96JA1.

Organism-specific databases

HPAiHPA011846.

Interactioni

Subunit structurei

Interacts with EGFR/ERBB1, ERBB2, ERBB3 and ERBB4.1 Publication

Protein-protein interaction databases

BioGridi117489. 9 interactions.
IntActiQ96JA1. 1 interaction.
STRINGi9606.ENSP00000273261.

Structurei

3D structure databases

ProteinModelPortaliQ96JA1.
SMRiQ96JA1. Positions 36-811.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 6834LRRNT
Add
BLAST
Repeati69 – 9022LRR 1
Add
BLAST
Repeati93 – 11422LRR 2
Add
BLAST
Repeati116 – 13722LRR 3
Add
BLAST
Repeati140 – 16122LRR 4
Add
BLAST
Repeati164 – 18522LRR 5
Add
BLAST
Repeati189 – 21022LRR 6
Add
BLAST
Repeati212 – 23322LRR 7
Add
BLAST
Repeati236 – 25722LRR 8
Add
BLAST
Repeati260 – 28122LRR 9
Add
BLAST
Repeati284 – 30522LRR 10
Add
BLAST
Repeati308 – 32922LRR 11
Add
BLAST
Repeati332 – 35322LRR 12
Add
BLAST
Repeati356 – 37823LRR 13
Add
BLAST
Repeati383 – 40422LRR 14
Add
BLAST
Repeati407 – 42822LRR 15
Add
BLAST
Domaini440 – 49152LRRCT
Add
BLAST
Domaini495 – 594100Ig-like C2-type 1
Add
BLAST
Domaini599 – 68890Ig-like C2-type 2
Add
BLAST
Domaini693 – 77987Ig-like C2-type 3
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi520 – 5245Poly-Ser

Domaini

The LRRs and the Ig-domains are each sufficient for EGFR/ERBB1 binding. This interaction is abolished only when these two domains are deleted.

Sequence similaritiesi

Contains 1 LRRCT domain.
Contains 1 LRRNT domain.

Keywords - Domaini

Immunoglobulin domain, Leucine-rich repeat, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG4886.
HOGENOMiHOG000113380.
HOVERGENiHBG052353.
InParanoidiQ96JA1.
OMAiESNGVCP.
OrthoDBiEOG7DNNTD.
PhylomeDBiQ96JA1.
TreeFamiTF325380.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
[Graphical view]
PfamiPF07679. I-set. 3 hits.
PF13855. LRR_8. 5 hits.
PF01463. LRRCT. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
SM00369. LRR_TYP. 2 hits.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
[Graphical view]
PROSITEiPS50835. IG_LIKE. 3 hits.
PS51450. LRR. 14 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96JA1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MARPVRGGLG APRRSPCLLL LWLLLLRLEP VTAAAGPRAP CAAACTCAGD     50
SLDCGGRGLA ALPGDLPSWT RSLNLSYNKL SEIDPAGFED LPNLQEVYLN 100
NNELTAVPSL GAASSHVVSL FLQHNKIRSV EGSQLKAYLS LEVLDLSLNN 150
ITEVRNTCFP HGPPIKELNL AGNRIGTLEL GAFDGLSRSL LTLRLSKNRI 200
TQLPVRAFKL PRLTQLDLNR NRIRLIEGLT FQGLNSLEVL KLQRNNISKL 250
TDGAFWGLSK MHVLHLEYNS LVEVNSGSLY GLTALHQLHL SNNSIARIHR 300
KGWSFCQKLH ELVLSFNNLT RLDEESLAEL SSLSVLRLSH NSISHIAEGA 350
FKGLRSLRVL DLDHNEISGT IEDTSGAFSG LDSLSKLTLF GNKIKSVAKR 400
AFSGLEGLEH LNLGGNAIRS VQFDAFVKMK NLKELHISSD SFLCDCQLKW 450
LPPWLIGRML QAFVTATCAH PESLKGQSIF SVPPESFVCD DFLKPQIITQ 500
PETTMAMVGK DIRFTCSAAS SSSSPMTFAW KKDNEVLTNA DMENFVHVHA 550
QDGEVMEYTT ILHLRQVTFG HEGRYQCVIT NHFGSTYSHK ARLTVNVLPS 600
FTKTPHDITI RTTTMARLEC AATGHPNPQI AWQKDGGTDF PAARERRMHV 650
MPDDDVFFIT DVKIDDAGVY SCTAQNSAGS ISANATLTVL ETPSLVVPLE 700
DRVVSVGETV ALQCKATGNP PPRITWFKGD RPLSLTERHH LTPDNQLLVV 750
QNVVAEDAGR YTCEMSNTLG TERAHSQLSV LPAAGCRKDG TTVGIFTIAV 800
VSSIVLTSLV WVCIIYQTRK KSEEYSVTNT DETVVPPDVP SYLSSQGTLS 850
DRQETVVRTE GGPQANGHIE SNGVCPRDAS HFPEPDTHSV ACRQPKLCAG 900
SAYHKEPWKA MEKAEGTPGP HKMEHGGRVV CSDCNTEVDC YSRGQAFHPQ 950
PVSRDSAQPS APNGPEPGGS DQEHSPHHQC SRTAAGSCPE CQGSLYPSNH 1000
DRMLTAVKKK PMASLDGKGD SSWTLARLYH PDSTELQPAS SLTSGSPERA 1050
EAQYLLVSNG HLPKACDASP ESTPLTGQLP GKQRVPLLLA PKS 1093
Length:1,093
Mass (Da):119,113
Last modified:April 3, 2007 - v2
Checksum:i7B4F13CA343AF943
GO
Isoform 2 (identifier: Q96JA1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-387: L → LLLLEPSQSAGCSSPSQPHMSAGGR
     644-691: RERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLE → Q

Show »
Length:1,070
Mass (Da):116,378
Checksum:i3EDFDDF0C1319D67
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti24 – 241L → V.
Corresponds to variant rs1403626 [ dbSNP | Ensembl ].
VAR_049889
Natural varianti615 – 6151M → V.2 Publications
Corresponds to variant rs2306272 [ dbSNP | Ensembl ].
VAR_031581
Natural varianti926 – 9261G → S.
Corresponds to variant rs9877201 [ dbSNP | Ensembl ].
VAR_031582
Natural varianti957 – 9571A → T.
Corresponds to variant rs332373 [ dbSNP | Ensembl ].
VAR_031583
Natural varianti993 – 9931G → A.
Corresponds to variant rs2279289 [ dbSNP | Ensembl ].
VAR_049890
Natural varianti1031 – 10311P → R.
Corresponds to variant rs332374 [ dbSNP | Ensembl ].
VAR_031584
Natural varianti1053 – 10531Q → P.
Corresponds to variant rs2279290 [ dbSNP | Ensembl ].
VAR_031585

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei387 – 3871L → LLLLEPSQSAGCSSPSQPHM SAGGR in isoform 2.
VSP_011730
Alternative sequencei644 – 69148RERRM…LTVLE → Q in isoform 2.
VSP_011731Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti24 – 263LLL → VLV in AAK62357. 1 Publication
Sequence conflicti24 – 263LLL → VLV in AAH71561. 1 Publication
Sequence conflicti80 – 801L → F in AAH71561. 1 Publication
Sequence conflicti612 – 6132TT → VR in CAB56036. 1 Publication
Sequence conflicti861 – 8611G → GA in BAB40659. 1 Publication
Sequence conflicti911 – 9111M → I in BAB40659. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF381545 mRNA. Translation: AAK62357.1.
AB050468 mRNA. Translation: BAB40659.1.
BC071561 mRNA. Translation: AAH71561.1.
BC014276 mRNA. Translation: AAH14276.2.
AL117666 mRNA. Translation: CAB56036.1.
CCDSiCCDS33783.1. [Q96JA1-1]
PIRiT17346.
RefSeqiNP_056356.2. NM_015541.2. [Q96JA1-1]
UniGeneiHs.518055.

Genome annotation databases

EnsembliENST00000273261; ENSP00000273261; ENSG00000144749. [Q96JA1-1]
ENST00000383703; ENSP00000373208; ENSG00000144749. [Q96JA1-2]
GeneIDi26018.
KEGGihsa:26018.
UCSCiuc003dmw.3. human. [Q96JA1-1]
uc010hoa.3. human. [Q96JA1-2]

Polymorphism databases

DMDMi143811415.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF381545 mRNA. Translation: AAK62357.1 .
AB050468 mRNA. Translation: BAB40659.1 .
BC071561 mRNA. Translation: AAH71561.1 .
BC014276 mRNA. Translation: AAH14276.2 .
AL117666 mRNA. Translation: CAB56036.1 .
CCDSi CCDS33783.1. [Q96JA1-1 ]
PIRi T17346.
RefSeqi NP_056356.2. NM_015541.2. [Q96JA1-1 ]
UniGenei Hs.518055.

3D structure databases

ProteinModelPortali Q96JA1.
SMRi Q96JA1. Positions 36-811.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117489. 9 interactions.
IntActi Q96JA1. 1 interaction.
STRINGi 9606.ENSP00000273261.

PTM databases

PhosphoSitei Q96JA1.

Polymorphism databases

DMDMi 143811415.

Proteomic databases

MaxQBi Q96JA1.
PaxDbi Q96JA1.
PRIDEi Q96JA1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000273261 ; ENSP00000273261 ; ENSG00000144749 . [Q96JA1-1 ]
ENST00000383703 ; ENSP00000373208 ; ENSG00000144749 . [Q96JA1-2 ]
GeneIDi 26018.
KEGGi hsa:26018.
UCSCi uc003dmw.3. human. [Q96JA1-1 ]
uc010hoa.3. human. [Q96JA1-2 ]

Organism-specific databases

CTDi 26018.
GeneCardsi GC03M066511.
H-InvDB HIX0003431.
HGNCi HGNC:17360. LRIG1.
HPAi HPA011846.
MIMi 608868. gene.
neXtProti NX_Q96JA1.
PharmGKBi PA38450.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4886.
HOGENOMi HOG000113380.
HOVERGENi HBG052353.
InParanoidi Q96JA1.
OMAi ESNGVCP.
OrthoDBi EOG7DNNTD.
PhylomeDBi Q96JA1.
TreeFami TF325380.

Enzyme and pathway databases

Reactomei REACT_9417. Signaling by EGFR.
SignaLinki Q96JA1.

Miscellaneous databases

ChiTaRSi LRIG1. human.
GeneWikii LRIG1.
GenomeRNAii 26018.
NextBioi 47784.
PROi Q96JA1.
SOURCEi Search...

Gene expression databases

Bgeei Q96JA1.
CleanExi HS_LIG1.
HS_LRIG1.
Genevestigatori Q96JA1.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
[Graphical view ]
Pfami PF07679. I-set. 3 hits.
PF13855. LRR_8. 5 hits.
PF01463. LRRCT. 1 hit.
[Graphical view ]
SMARTi SM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
SM00369. LRR_TYP. 2 hits.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
[Graphical view ]
PROSITEi PS50835. IG_LIKE. 3 hits.
PS51450. LRR. 14 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-615.
  2. "Human membrane glycoprotein LIG-1."
    Suzuki Y.
    Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lymph and Placenta.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 611-1093, VARIANT VAL-615.
    Tissue: Uterus.
  5. "LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation."
    Gur G., Rubin C., Katz M., Amit I., Citri A., Nilsson J., Amariglio N., Henriksson R., Rechavi G., Hedman H., Wides R., Yarden Y.
    EMBO J. 23:3270-3281(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INDUCTION, INTERACTION WITH EGFR; ERBB2; ERBB3 AND ERBB4.

Entry informationi

Entry nameiLRIG1_HUMAN
AccessioniPrimary (citable) accession number: Q96JA1
Secondary accession number(s): Q6IQ51
, Q96CF9, Q9BYB8, Q9UFI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: April 3, 2007
Last modified: September 3, 2014
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi