Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96JA1 (LRIG1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Leucine-rich repeats and immunoglobulin-like domains protein 1

Short name=LIG-1
Gene names
Name:LRIG1
Synonyms:LIG1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1093 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a feedback negative regulator of signaling by receptor tyrosine kinases, through a mechanism that involves enhancement of receptor ubiquitination and accelerated intracellular degradation. Ref.5

Subunit structure

Interacts with EGFR/ERBB1, ERBB2, ERBB3 and ERBB4. Ref.5

Subcellular location

Membrane; Single-pass type I membrane protein Ref.1.

Tissue specificity

Widely expressed. Ref.1

Induction

By EGF. Ref.5

Domain

The LRRs and the Ig-domains are each sufficient for EGFR/ERBB1 binding. This interaction is abolished only when these two domains are deleted.

Sequence similarities

Contains 3 Ig-like C2-type (immunoglobulin-like) domains.

Contains 15 LRR (leucine-rich) repeats.

Contains 1 LRRCT domain.

Contains 1 LRRNT domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96JA1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96JA1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     387-387: L → LLLLEPSQSAGCSSPSQPHMSAGGR
     644-691: RERRMHVMPDDDVFFITDVKIDDAGVYSCTAQNSAGSISANATLTVLE → Q

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3434 Potential
Chain35 – 10931059Leucine-rich repeats and immunoglobulin-like domains protein 1
PRO_0000014827

Regions

Topological domain35 – 794760Extracellular Potential
Transmembrane795 – 81521Helical; Potential
Topological domain816 – 1093278Cytoplasmic Potential
Domain35 – 6834LRRNT
Repeat69 – 9022LRR 1
Repeat93 – 11422LRR 2
Repeat116 – 13722LRR 3
Repeat140 – 16122LRR 4
Repeat164 – 18522LRR 5
Repeat189 – 21022LRR 6
Repeat212 – 23322LRR 7
Repeat236 – 25722LRR 8
Repeat260 – 28122LRR 9
Repeat284 – 30522LRR 10
Repeat308 – 32922LRR 11
Repeat332 – 35322LRR 12
Repeat356 – 37823LRR 13
Repeat383 – 40422LRR 14
Repeat407 – 42822LRR 15
Domain440 – 49152LRRCT
Domain495 – 594100Ig-like C2-type 1
Domain599 – 68890Ig-like C2-type 2
Domain693 – 77987Ig-like C2-type 3
Compositional bias520 – 5245Poly-Ser

Amino acid modifications

Glycosylation741N-linked (GlcNAc...) Potential
Glycosylation1501N-linked (GlcNAc...) Potential
Glycosylation2461N-linked (GlcNAc...) Potential
Glycosylation2921N-linked (GlcNAc...) Potential
Glycosylation3181N-linked (GlcNAc...) Potential
Glycosylation6841N-linked (GlcNAc...) Potential
Disulfide bond516 ↔ 577 By similarity
Disulfide bond620 ↔ 672 By similarity
Disulfide bond714 ↔ 763 By similarity

Natural variations

Alternative sequence3871L → LLLLEPSQSAGCSSPSQPHM SAGGR in isoform 2.
VSP_011730
Alternative sequence644 – 69148RERRM…LTVLE → Q in isoform 2.
VSP_011731
Natural variant241L → V.
Corresponds to variant rs1403626 [ dbSNP | Ensembl ].
VAR_049889
Natural variant6151M → V. Ref.1 Ref.4
Corresponds to variant rs2306272 [ dbSNP | Ensembl ].
VAR_031581
Natural variant9261G → S.
Corresponds to variant rs9877201 [ dbSNP | Ensembl ].
VAR_031582
Natural variant9571A → T.
Corresponds to variant rs332373 [ dbSNP | Ensembl ].
VAR_031583
Natural variant9931G → A.
Corresponds to variant rs2279289 [ dbSNP | Ensembl ].
VAR_049890
Natural variant10311P → R.
Corresponds to variant rs332374 [ dbSNP | Ensembl ].
VAR_031584
Natural variant10531Q → P.
Corresponds to variant rs2279290 [ dbSNP | Ensembl ].
VAR_031585

Experimental info

Sequence conflict24 – 263LLL → VLV in AAK62357. Ref.1
Sequence conflict24 – 263LLL → VLV in AAH71561. Ref.3
Sequence conflict801L → F in AAH71561. Ref.3
Sequence conflict612 – 6132TT → VR in CAB56036. Ref.4
Sequence conflict8611G → GA in BAB40659. Ref.2
Sequence conflict9111M → I in BAB40659. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 3, 2007. Version 2.
Checksum: 7B4F13CA343AF943

FASTA1,093119,113
        10         20         30         40         50         60 
MARPVRGGLG APRRSPCLLL LWLLLLRLEP VTAAAGPRAP CAAACTCAGD SLDCGGRGLA 

        70         80         90        100        110        120 
ALPGDLPSWT RSLNLSYNKL SEIDPAGFED LPNLQEVYLN NNELTAVPSL GAASSHVVSL 

       130        140        150        160        170        180 
FLQHNKIRSV EGSQLKAYLS LEVLDLSLNN ITEVRNTCFP HGPPIKELNL AGNRIGTLEL 

       190        200        210        220        230        240 
GAFDGLSRSL LTLRLSKNRI TQLPVRAFKL PRLTQLDLNR NRIRLIEGLT FQGLNSLEVL 

       250        260        270        280        290        300 
KLQRNNISKL TDGAFWGLSK MHVLHLEYNS LVEVNSGSLY GLTALHQLHL SNNSIARIHR 

       310        320        330        340        350        360 
KGWSFCQKLH ELVLSFNNLT RLDEESLAEL SSLSVLRLSH NSISHIAEGA FKGLRSLRVL 

       370        380        390        400        410        420 
DLDHNEISGT IEDTSGAFSG LDSLSKLTLF GNKIKSVAKR AFSGLEGLEH LNLGGNAIRS 

       430        440        450        460        470        480 
VQFDAFVKMK NLKELHISSD SFLCDCQLKW LPPWLIGRML QAFVTATCAH PESLKGQSIF 

       490        500        510        520        530        540 
SVPPESFVCD DFLKPQIITQ PETTMAMVGK DIRFTCSAAS SSSSPMTFAW KKDNEVLTNA 

       550        560        570        580        590        600 
DMENFVHVHA QDGEVMEYTT ILHLRQVTFG HEGRYQCVIT NHFGSTYSHK ARLTVNVLPS 

       610        620        630        640        650        660 
FTKTPHDITI RTTTMARLEC AATGHPNPQI AWQKDGGTDF PAARERRMHV MPDDDVFFIT 

       670        680        690        700        710        720 
DVKIDDAGVY SCTAQNSAGS ISANATLTVL ETPSLVVPLE DRVVSVGETV ALQCKATGNP 

       730        740        750        760        770        780 
PPRITWFKGD RPLSLTERHH LTPDNQLLVV QNVVAEDAGR YTCEMSNTLG TERAHSQLSV 

       790        800        810        820        830        840 
LPAAGCRKDG TTVGIFTIAV VSSIVLTSLV WVCIIYQTRK KSEEYSVTNT DETVVPPDVP 

       850        860        870        880        890        900 
SYLSSQGTLS DRQETVVRTE GGPQANGHIE SNGVCPRDAS HFPEPDTHSV ACRQPKLCAG 

       910        920        930        940        950        960 
SAYHKEPWKA MEKAEGTPGP HKMEHGGRVV CSDCNTEVDC YSRGQAFHPQ PVSRDSAQPS 

       970        980        990       1000       1010       1020 
APNGPEPGGS DQEHSPHHQC SRTAAGSCPE CQGSLYPSNH DRMLTAVKKK PMASLDGKGD 

      1030       1040       1050       1060       1070       1080 
SSWTLARLYH PDSTELQPAS SLTSGSPERA EAQYLLVSNG HLPKACDASP ESTPLTGQLP 

      1090 
GKQRVPLLLA PKS 

« Hide

Isoform 2 [UniParc].

Checksum: 3EDFDDF0C1319D67
Show »

FASTA1,070116,378

References

« Hide 'large scale' references
[1]"Cloning, characterization, and expression of human LIG1."
Nilsson J., Vallbo C., Guo D., Golovleva I., Hallberg B., Henriksson R., Hedman H.
Biochem. Biophys. Res. Commun. 284:1155-1161(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT VAL-615.
[2]"Human membrane glycoprotein LIG-1."
Suzuki Y.
Submitted (OCT-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Lymph and Placenta.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 611-1093, VARIANT VAL-615.
Tissue: Uterus.
[5]"LRIG1 restricts growth factor signaling by enhancing receptor ubiquitylation and degradation."
Gur G., Rubin C., Katz M., Amit I., Citri A., Nilsson J., Amariglio N., Henriksson R., Rechavi G., Hedman H., Wides R., Yarden Y.
EMBO J. 23:3270-3281(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INDUCTION, INTERACTION WITH EGFR; ERBB2; ERBB3 AND ERBB4.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF381545 mRNA. Translation: AAK62357.1.
AB050468 mRNA. Translation: BAB40659.1.
BC071561 mRNA. Translation: AAH71561.1.
BC014276 mRNA. Translation: AAH14276.2.
AL117666 mRNA. Translation: CAB56036.1.
CCDSCCDS33783.1. [Q96JA1-1]
PIRT17346.
RefSeqNP_056356.2. NM_015541.2. [Q96JA1-1]
UniGeneHs.518055.

3D structure databases

ProteinModelPortalQ96JA1.
SMRQ96JA1. Positions 36-811.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117489. 9 interactions.
IntActQ96JA1. 1 interaction.
STRING9606.ENSP00000273261.

PTM databases

PhosphoSiteQ96JA1.

Polymorphism databases

DMDM143811415.

Proteomic databases

MaxQBQ96JA1.
PaxDbQ96JA1.
PRIDEQ96JA1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000273261; ENSP00000273261; ENSG00000144749. [Q96JA1-1]
ENST00000383703; ENSP00000373208; ENSG00000144749. [Q96JA1-2]
GeneID26018.
KEGGhsa:26018.
UCSCuc003dmw.3. human. [Q96JA1-1]
uc010hoa.3. human. [Q96JA1-2]

Organism-specific databases

CTD26018.
GeneCardsGC03M066511.
H-InvDBHIX0003431.
HGNCHGNC:17360. LRIG1.
HPAHPA011846.
MIM608868. gene.
neXtProtNX_Q96JA1.
PharmGKBPA38450.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG4886.
HOGENOMHOG000113380.
HOVERGENHBG052353.
InParanoidQ96JA1.
OMAESNGVCP.
OrthoDBEOG7DNNTD.
PhylomeDBQ96JA1.
TreeFamTF325380.

Enzyme and pathway databases

SignaLinkQ96JA1.

Gene expression databases

BgeeQ96JA1.
CleanExHS_LIG1.
HS_LRIG1.
GenevestigatorQ96JA1.

Family and domain databases

Gene3D2.60.40.10. 3 hits.
InterProIPR000483. Cys-rich_flank_reg_C.
IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR013098. Ig_I-set.
IPR003599. Ig_sub.
IPR003598. Ig_sub2.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
IPR000372. LRR-contain_N.
[Graphical view]
PfamPF07679. I-set. 3 hits.
PF13855. LRR_8. 5 hits.
PF01463. LRRCT. 1 hit.
[Graphical view]
SMARTSM00409. IG. 1 hit.
SM00408. IGc2. 2 hits.
SM00369. LRR_TYP. 2 hits.
SM00082. LRRCT. 1 hit.
SM00013. LRRNT. 1 hit.
[Graphical view]
PROSITEPS50835. IG_LIKE. 3 hits.
PS51450. LRR. 14 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSLRIG1. human.
GeneWikiLRIG1.
GenomeRNAi26018.
NextBio47784.
PROQ96JA1.
SOURCESearch...

Entry information

Entry nameLRIG1_HUMAN
AccessionPrimary (citable) accession number: Q96JA1
Secondary accession number(s): Q6IQ51 expand/collapse secondary AC list , Q96CF9, Q9BYB8, Q9UFI4
Entry history
Integrated into UniProtKB/Swiss-Prot: October 11, 2004
Last sequence update: April 3, 2007
Last modified: July 9, 2014
This is version 108 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM